Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2S4KZN3

Protein Details
Accession A0A2S4KZN3    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
12-31FERTHRPPTRPPHRRAQTDPBasic
NLS Segment(s)
Subcellular Location(s) mito_nucl 10.166, nucl 10, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR019145  Mediator_Med10  
Gene Ontology GO:0016592  C:mediator complex  
GO:0003712  F:transcription coregulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF09748  Med10  
Amino Acid Sequences MAPVDRMSHEEFERTHRPPTRPPHRRAQTDPPLEQLKDVIQDFYQIMVQVSTYDTTGRPSRDVLSNEVKTLSRSLQALHASASSPHGAALPSVPPELLEYVENGRNPDIYTREFVELVRRGNQLMRGKVRAFAAFRDVLAEHLAHAMPELRADVDRVLEATGGPPLGSASSAEGGNGSTAPAARAEAASTAGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.42
3 0.46
4 0.5
5 0.55
6 0.64
7 0.68
8 0.71
9 0.74
10 0.76
11 0.78
12 0.81
13 0.8
14 0.8
15 0.79
16 0.77
17 0.73
18 0.67
19 0.63
20 0.55
21 0.48
22 0.38
23 0.3
24 0.26
25 0.25
26 0.2
27 0.14
28 0.16
29 0.16
30 0.15
31 0.14
32 0.1
33 0.1
34 0.08
35 0.08
36 0.07
37 0.08
38 0.07
39 0.07
40 0.08
41 0.08
42 0.12
43 0.16
44 0.16
45 0.17
46 0.18
47 0.2
48 0.25
49 0.27
50 0.28
51 0.33
52 0.32
53 0.32
54 0.32
55 0.29
56 0.24
57 0.24
58 0.2
59 0.13
60 0.13
61 0.13
62 0.16
63 0.17
64 0.16
65 0.15
66 0.14
67 0.12
68 0.12
69 0.13
70 0.09
71 0.08
72 0.07
73 0.07
74 0.07
75 0.07
76 0.07
77 0.06
78 0.07
79 0.07
80 0.07
81 0.06
82 0.07
83 0.07
84 0.07
85 0.06
86 0.06
87 0.08
88 0.11
89 0.11
90 0.11
91 0.11
92 0.11
93 0.11
94 0.12
95 0.13
96 0.12
97 0.13
98 0.15
99 0.16
100 0.16
101 0.16
102 0.2
103 0.2
104 0.21
105 0.23
106 0.21
107 0.21
108 0.22
109 0.29
110 0.28
111 0.32
112 0.34
113 0.34
114 0.34
115 0.36
116 0.36
117 0.33
118 0.28
119 0.23
120 0.24
121 0.2
122 0.19
123 0.19
124 0.17
125 0.14
126 0.14
127 0.13
128 0.09
129 0.1
130 0.1
131 0.07
132 0.08
133 0.08
134 0.07
135 0.08
136 0.08
137 0.07
138 0.08
139 0.09
140 0.09
141 0.09
142 0.09
143 0.09
144 0.09
145 0.08
146 0.08
147 0.07
148 0.08
149 0.07
150 0.07
151 0.06
152 0.06
153 0.06
154 0.07
155 0.07
156 0.08
157 0.09
158 0.09
159 0.09
160 0.09
161 0.09
162 0.1
163 0.09
164 0.07
165 0.06
166 0.07
167 0.08
168 0.08
169 0.09
170 0.09
171 0.09
172 0.1
173 0.1