Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4KVQ6

Protein Details
Accession A0A2S4KVQ6   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
6-31LVSRHLRQRKLNSPIHPRQHHRNPRLHydrophilic
99-133AATPGRRPCKRTPNRGHKRRQQRTHTTARQRQARLHydrophilic
NLS Segment(s)
PositionSequence
90-121RPPHLSRAPAATPGRRPCKRTPNRGHKRRQQR
Subcellular Location(s) nucl 13, cyto_nucl 10, mito 9, cyto 5
Family & Domain DBs
Amino Acid Sequences AEGGWLVSRHLRQRKLNSPIHPRQHHRNPRLASINHHKPTIRRPIASLAFPRAHLFSPNDPFPLNKQHPETSPRCPSRRPPMTRTFPAARPPHLSRAPAATPGRRPCKRTPNRGHKRRQQRTHTTARQRQARLGLVPAAPKDAISL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.74
3 0.77
4 0.77
5 0.79
6 0.8
7 0.82
8 0.81
9 0.78
10 0.79
11 0.82
12 0.84
13 0.8
14 0.79
15 0.72
16 0.72
17 0.74
18 0.65
19 0.62
20 0.61
21 0.65
22 0.58
23 0.57
24 0.51
25 0.45
26 0.52
27 0.55
28 0.5
29 0.4
30 0.4
31 0.45
32 0.46
33 0.47
34 0.42
35 0.36
36 0.32
37 0.32
38 0.3
39 0.24
40 0.21
41 0.2
42 0.21
43 0.2
44 0.24
45 0.24
46 0.24
47 0.23
48 0.23
49 0.23
50 0.29
51 0.27
52 0.27
53 0.29
54 0.3
55 0.33
56 0.39
57 0.4
58 0.37
59 0.44
60 0.46
61 0.44
62 0.45
63 0.49
64 0.53
65 0.6
66 0.59
67 0.57
68 0.6
69 0.66
70 0.66
71 0.65
72 0.59
73 0.51
74 0.54
75 0.5
76 0.43
77 0.42
78 0.42
79 0.43
80 0.42
81 0.4
82 0.32
83 0.35
84 0.33
85 0.33
86 0.34
87 0.3
88 0.35
89 0.42
90 0.51
91 0.51
92 0.56
93 0.57
94 0.65
95 0.71
96 0.75
97 0.78
98 0.79
99 0.86
100 0.9
101 0.92
102 0.9
103 0.92
104 0.92
105 0.91
106 0.9
107 0.9
108 0.88
109 0.89
110 0.89
111 0.89
112 0.86
113 0.85
114 0.84
115 0.76
116 0.73
117 0.68
118 0.62
119 0.53
120 0.48
121 0.43
122 0.36
123 0.37
124 0.32
125 0.29
126 0.24