Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2S4KPZ1

Protein Details
Accession A0A2S4KPZ1    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
130-158PPSLRRRAPRAPTPRRRQPPSPRGPPRGABasic
NLS Segment(s)
PositionSequence
71-81RPPRVGSPVRR
133-165LRRRAPRAPTPRRRQPPSPRGPPRGALRRRRIL
Subcellular Location(s) cyto 8.5, cyto_nucl 8, nucl 6.5, mito 4, plas 3, extr 2
Family & Domain DBs
Amino Acid Sequences MLTAAEPEPEPSKRAPTPRSWVGRLSSVFGGGGGDDGPAVEEGDGAKHAWGLPDAEPEGGRLERSSRAQHRPPRVGSPVRRRPESPRTVAADVDVEAADHAPAHDDSDASLADEELSDPSTSDDPPQTLPPSLRRRAPRAPTPRRRQPPSPRGPPRGALRRRRILADLGGSRRALAHPQRRLVVAVVVGLAAAPRLAAQPGLDVVVGVADARRGAGAAGRGAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.45
3 0.49
4 0.56
5 0.62
6 0.68
7 0.63
8 0.61
9 0.56
10 0.57
11 0.5
12 0.45
13 0.36
14 0.29
15 0.26
16 0.21
17 0.18
18 0.11
19 0.1
20 0.06
21 0.05
22 0.04
23 0.04
24 0.05
25 0.05
26 0.05
27 0.04
28 0.05
29 0.05
30 0.06
31 0.07
32 0.07
33 0.06
34 0.07
35 0.07
36 0.08
37 0.08
38 0.1
39 0.1
40 0.13
41 0.14
42 0.14
43 0.13
44 0.13
45 0.15
46 0.13
47 0.13
48 0.1
49 0.12
50 0.15
51 0.19
52 0.26
53 0.31
54 0.39
55 0.47
56 0.55
57 0.62
58 0.65
59 0.65
60 0.63
61 0.63
62 0.63
63 0.64
64 0.67
65 0.67
66 0.66
67 0.65
68 0.62
69 0.63
70 0.64
71 0.62
72 0.56
73 0.52
74 0.51
75 0.49
76 0.46
77 0.39
78 0.29
79 0.22
80 0.18
81 0.12
82 0.07
83 0.06
84 0.06
85 0.05
86 0.04
87 0.04
88 0.04
89 0.04
90 0.05
91 0.05
92 0.05
93 0.05
94 0.07
95 0.07
96 0.05
97 0.05
98 0.05
99 0.04
100 0.04
101 0.04
102 0.04
103 0.05
104 0.04
105 0.05
106 0.06
107 0.07
108 0.07
109 0.08
110 0.09
111 0.09
112 0.1
113 0.13
114 0.13
115 0.13
116 0.15
117 0.23
118 0.3
119 0.33
120 0.38
121 0.4
122 0.46
123 0.53
124 0.58
125 0.59
126 0.63
127 0.7
128 0.75
129 0.79
130 0.83
131 0.84
132 0.84
133 0.84
134 0.84
135 0.84
136 0.84
137 0.85
138 0.84
139 0.81
140 0.77
141 0.73
142 0.71
143 0.71
144 0.7
145 0.69
146 0.69
147 0.7
148 0.69
149 0.67
150 0.6
151 0.53
152 0.47
153 0.44
154 0.41
155 0.35
156 0.35
157 0.32
158 0.3
159 0.27
160 0.24
161 0.25
162 0.29
163 0.35
164 0.39
165 0.44
166 0.46
167 0.46
168 0.47
169 0.4
170 0.33
171 0.24
172 0.17
173 0.13
174 0.1
175 0.09
176 0.07
177 0.06
178 0.04
179 0.03
180 0.03
181 0.03
182 0.04
183 0.05
184 0.06
185 0.06
186 0.07
187 0.08
188 0.09
189 0.09
190 0.08
191 0.07
192 0.07
193 0.06
194 0.05
195 0.05
196 0.04
197 0.04
198 0.05
199 0.05
200 0.05
201 0.05
202 0.08
203 0.11