Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4KS69

Protein Details
Accession A0A2S4KS69   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
10-33LYSRVQTILQRRRKQKRAVEISAPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25, cyto 1.5, cyto_nucl 1.5
Family & Domain DBs
Amino Acid Sequences MRLKNDIRMLYSRVQTILQRRRKQKRAVEISAPFNVKMEPVSLPGISEDEISMLREKAAASRIGVFETMPPRSRSPSIHKISRPRQPAVITVLPPLAVVATRPAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.39
4 0.45
5 0.49
6 0.55
7 0.64
8 0.73
9 0.8
10 0.85
11 0.83
12 0.84
13 0.83
14 0.8
15 0.78
16 0.72
17 0.68
18 0.63
19 0.55
20 0.44
21 0.35
22 0.29
23 0.2
24 0.16
25 0.12
26 0.08
27 0.09
28 0.11
29 0.1
30 0.1
31 0.1
32 0.1
33 0.09
34 0.09
35 0.06
36 0.05
37 0.06
38 0.06
39 0.07
40 0.06
41 0.06
42 0.06
43 0.06
44 0.07
45 0.09
46 0.09
47 0.09
48 0.11
49 0.12
50 0.12
51 0.12
52 0.11
53 0.12
54 0.15
55 0.17
56 0.18
57 0.2
58 0.21
59 0.26
60 0.28
61 0.31
62 0.36
63 0.43
64 0.48
65 0.53
66 0.58
67 0.64
68 0.7
69 0.73
70 0.7
71 0.63
72 0.61
73 0.55
74 0.53
75 0.5
76 0.47
77 0.39
78 0.35
79 0.32
80 0.27
81 0.24
82 0.2
83 0.13
84 0.08
85 0.08