Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4L8R8

Protein Details
Accession A0A2S4L8R8    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
15-41SSSFTRTTSKPSRKPGRRSESHHAKALHydrophilic
54-78AESAPPPKQAKKRKTKFQHEDEALDHydrophilic
NLS Segment(s)
PositionSequence
24-69KPSRKPGRRSESHHAKALINLKMSNPKKRVAESAPPPKQAKKRKTK
155-161KKAPKKK
Subcellular Location(s) nucl 10, cyto_nucl 9.833, mito_nucl 9.833, mito 8.5, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR032704  Cms1  
IPR027417  P-loop_NTPase  
Pfam View protein in Pfam  
PF14617  CMS1  
Amino Acid Sequences GNGQRRSQGIKFSASSSFTRTTSKPSRKPGRRSESHHAKALINLKMSNPKKRVAESAPPPKQAKKRKTKFQHEDEALDTELGLNTLFTRMDNQLLADHLAQKITRFGGDLSSVELADLTVSANSIQDTTAWQEKRTLDNLPGFLEKFTEDPASLKKAPKKKGSPHTLIVAGAGLRAADIVRATRKFSGKDNTVAKLFAKHMKVDEQVAFLKNTKTGIGVGTPARLMELIDDGALSLDNLKRLVVDASHIDQKKRGVMDMKDTMMPLARFLVRGDFKARYADAKKPLALLFY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.37
3 0.34
4 0.34
5 0.3
6 0.33
7 0.32
8 0.37
9 0.44
10 0.53
11 0.56
12 0.63
13 0.73
14 0.78
15 0.87
16 0.88
17 0.88
18 0.87
19 0.87
20 0.87
21 0.87
22 0.83
23 0.79
24 0.71
25 0.61
26 0.58
27 0.57
28 0.5
29 0.41
30 0.37
31 0.33
32 0.4
33 0.45
34 0.48
35 0.44
36 0.46
37 0.48
38 0.5
39 0.54
40 0.5
41 0.55
42 0.56
43 0.64
44 0.64
45 0.66
46 0.67
47 0.67
48 0.7
49 0.71
50 0.71
51 0.72
52 0.75
53 0.79
54 0.87
55 0.9
56 0.91
57 0.89
58 0.89
59 0.81
60 0.74
61 0.65
62 0.57
63 0.45
64 0.35
65 0.26
66 0.16
67 0.12
68 0.09
69 0.07
70 0.04
71 0.04
72 0.05
73 0.05
74 0.05
75 0.08
76 0.09
77 0.11
78 0.11
79 0.11
80 0.11
81 0.12
82 0.13
83 0.11
84 0.12
85 0.1
86 0.11
87 0.11
88 0.11
89 0.12
90 0.11
91 0.1
92 0.09
93 0.09
94 0.09
95 0.11
96 0.1
97 0.1
98 0.1
99 0.1
100 0.09
101 0.08
102 0.06
103 0.05
104 0.05
105 0.03
106 0.03
107 0.03
108 0.03
109 0.04
110 0.04
111 0.04
112 0.04
113 0.04
114 0.05
115 0.08
116 0.14
117 0.14
118 0.15
119 0.19
120 0.2
121 0.23
122 0.24
123 0.23
124 0.2
125 0.22
126 0.23
127 0.2
128 0.2
129 0.17
130 0.15
131 0.14
132 0.11
133 0.09
134 0.09
135 0.08
136 0.07
137 0.08
138 0.1
139 0.15
140 0.17
141 0.21
142 0.26
143 0.33
144 0.4
145 0.48
146 0.54
147 0.58
148 0.66
149 0.7
150 0.69
151 0.64
152 0.6
153 0.52
154 0.44
155 0.35
156 0.25
157 0.16
158 0.11
159 0.08
160 0.05
161 0.03
162 0.03
163 0.03
164 0.03
165 0.03
166 0.05
167 0.1
168 0.11
169 0.13
170 0.18
171 0.21
172 0.22
173 0.27
174 0.33
175 0.32
176 0.39
177 0.4
178 0.39
179 0.37
180 0.36
181 0.31
182 0.27
183 0.26
184 0.25
185 0.24
186 0.22
187 0.23
188 0.26
189 0.27
190 0.28
191 0.26
192 0.23
193 0.23
194 0.24
195 0.23
196 0.21
197 0.2
198 0.18
199 0.17
200 0.15
201 0.13
202 0.12
203 0.12
204 0.11
205 0.13
206 0.12
207 0.13
208 0.12
209 0.11
210 0.11
211 0.1
212 0.09
213 0.07
214 0.07
215 0.07
216 0.06
217 0.06
218 0.06
219 0.06
220 0.06
221 0.05
222 0.06
223 0.07
224 0.09
225 0.09
226 0.09
227 0.09
228 0.1
229 0.12
230 0.09
231 0.11
232 0.14
233 0.17
234 0.26
235 0.28
236 0.28
237 0.3
238 0.32
239 0.35
240 0.32
241 0.34
242 0.33
243 0.34
244 0.41
245 0.43
246 0.43
247 0.39
248 0.38
249 0.34
250 0.32
251 0.29
252 0.21
253 0.2
254 0.18
255 0.18
256 0.18
257 0.26
258 0.24
259 0.26
260 0.31
261 0.29
262 0.3
263 0.34
264 0.34
265 0.35
266 0.37
267 0.42
268 0.45
269 0.48
270 0.48
271 0.46