Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2S4KPP1

Protein Details
Accession A0A2S4KPP1    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
164-183SDPESERPLKRRLRPRKANNBasic
NLS Segment(s)
PositionSequence
123-131KTGGSKKRK
171-181PLKRRLRPRKA
Subcellular Location(s) nucl 9, cyto 7, mito_nucl 7, mito 5
Family & Domain DBs
Amino Acid Sequences MVAAPMPAPQTDLGDMVMYGFGAIPTIGSAMTADTATDAAPNTGAPSTARGASTTGVRKIILKRSGAKKPAATQAATKTAATKTTANNTGAKTGADTGAAANDGVPCIAANSTAGGPSKSGAKTGGSKKRKASNDEEPTAPAAPPSNNNDENNAGGPCIVVETSDPESERPLKRRLRPRKANN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.1
4 0.1
5 0.07
6 0.06
7 0.05
8 0.04
9 0.04
10 0.04
11 0.04
12 0.04
13 0.04
14 0.04
15 0.04
16 0.04
17 0.04
18 0.05
19 0.05
20 0.05
21 0.05
22 0.05
23 0.05
24 0.06
25 0.06
26 0.05
27 0.06
28 0.06
29 0.07
30 0.07
31 0.07
32 0.07
33 0.09
34 0.11
35 0.12
36 0.12
37 0.12
38 0.13
39 0.13
40 0.18
41 0.19
42 0.2
43 0.19
44 0.2
45 0.23
46 0.26
47 0.34
48 0.33
49 0.32
50 0.38
51 0.45
52 0.52
53 0.52
54 0.51
55 0.46
56 0.45
57 0.49
58 0.44
59 0.38
60 0.33
61 0.32
62 0.34
63 0.32
64 0.27
65 0.22
66 0.2
67 0.21
68 0.2
69 0.18
70 0.15
71 0.19
72 0.23
73 0.22
74 0.25
75 0.24
76 0.23
77 0.21
78 0.19
79 0.14
80 0.11
81 0.1
82 0.07
83 0.06
84 0.05
85 0.05
86 0.05
87 0.05
88 0.04
89 0.04
90 0.04
91 0.03
92 0.03
93 0.03
94 0.03
95 0.04
96 0.03
97 0.03
98 0.05
99 0.05
100 0.06
101 0.07
102 0.07
103 0.07
104 0.07
105 0.12
106 0.11
107 0.12
108 0.11
109 0.13
110 0.2
111 0.3
112 0.4
113 0.41
114 0.46
115 0.52
116 0.6
117 0.64
118 0.63
119 0.61
120 0.62
121 0.65
122 0.63
123 0.58
124 0.5
125 0.46
126 0.41
127 0.33
128 0.23
129 0.16
130 0.14
131 0.18
132 0.22
133 0.27
134 0.3
135 0.31
136 0.34
137 0.33
138 0.33
139 0.31
140 0.26
141 0.19
142 0.14
143 0.13
144 0.1
145 0.09
146 0.07
147 0.05
148 0.06
149 0.1
150 0.13
151 0.16
152 0.17
153 0.16
154 0.22
155 0.29
156 0.35
157 0.37
158 0.43
159 0.5
160 0.59
161 0.7
162 0.76
163 0.8