Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4KPT5

Protein Details
Accession A0A2S4KPT5    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
84-106SAPAPPGTKKKPGRKPKTDTSSSHydrophilic
249-271GIREFMKQEKRLKEKHQREGSVGBasic
NLS Segment(s)
PositionSequence
79-100GRKPESAPAPPGTKKKPGRKPK
Subcellular Location(s) mito 21, cyto_mito 12.333, mito_nucl 12.333, nucl 2.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019180  Oxidoreductase-like_N  
IPR039251  OXLD1  
Pfam View protein in Pfam  
PF09791  Oxidored-like  
Amino Acid Sequences MLAPTRLAATRLCLLRSISSNPSRCFTSTRCAAKDEAWPQRCSLGPYYERILRNPTPYALNDKPEEPPSSADPDVLPPGRKPESAPAPPGTKKKPGRKPKTDTSSSSHTPPESSSTSPPAPSPPPATVAEKARIVFGSRLLGPAEQADRLATKMAQSTYIAGVLVPPRPEEPDNCCMSGCVNCVWDRFRDDMEEWSAKKNDAQTRLKAGGQTMDADGGGSEASWGVNIGSAKITKDMWDEDVFQSVPVGIREFMKQEKRLKEKHQREGSVGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.29
3 0.32
4 0.33
5 0.35
6 0.41
7 0.47
8 0.47
9 0.48
10 0.47
11 0.45
12 0.45
13 0.4
14 0.4
15 0.42
16 0.48
17 0.47
18 0.46
19 0.46
20 0.44
21 0.5
22 0.5
23 0.51
24 0.48
25 0.47
26 0.46
27 0.47
28 0.46
29 0.41
30 0.36
31 0.34
32 0.31
33 0.34
34 0.38
35 0.41
36 0.41
37 0.39
38 0.42
39 0.37
40 0.4
41 0.38
42 0.35
43 0.32
44 0.32
45 0.39
46 0.35
47 0.35
48 0.33
49 0.32
50 0.34
51 0.34
52 0.34
53 0.27
54 0.27
55 0.25
56 0.29
57 0.27
58 0.24
59 0.21
60 0.21
61 0.24
62 0.23
63 0.22
64 0.17
65 0.23
66 0.25
67 0.25
68 0.25
69 0.28
70 0.35
71 0.36
72 0.4
73 0.37
74 0.41
75 0.45
76 0.5
77 0.46
78 0.47
79 0.53
80 0.59
81 0.66
82 0.71
83 0.77
84 0.81
85 0.84
86 0.85
87 0.85
88 0.8
89 0.74
90 0.68
91 0.64
92 0.56
93 0.5
94 0.42
95 0.33
96 0.28
97 0.25
98 0.24
99 0.2
100 0.2
101 0.19
102 0.21
103 0.22
104 0.22
105 0.21
106 0.2
107 0.2
108 0.2
109 0.21
110 0.17
111 0.2
112 0.21
113 0.24
114 0.23
115 0.24
116 0.24
117 0.23
118 0.22
119 0.19
120 0.17
121 0.16
122 0.13
123 0.11
124 0.11
125 0.09
126 0.1
127 0.1
128 0.1
129 0.08
130 0.09
131 0.09
132 0.07
133 0.07
134 0.07
135 0.07
136 0.07
137 0.08
138 0.06
139 0.06
140 0.09
141 0.09
142 0.1
143 0.1
144 0.1
145 0.1
146 0.1
147 0.09
148 0.07
149 0.08
150 0.08
151 0.1
152 0.09
153 0.1
154 0.1
155 0.13
156 0.15
157 0.16
158 0.21
159 0.25
160 0.28
161 0.27
162 0.27
163 0.24
164 0.24
165 0.23
166 0.18
167 0.13
168 0.12
169 0.13
170 0.15
171 0.17
172 0.18
173 0.19
174 0.19
175 0.19
176 0.21
177 0.21
178 0.22
179 0.26
180 0.28
181 0.26
182 0.29
183 0.29
184 0.26
185 0.27
186 0.31
187 0.32
188 0.37
189 0.42
190 0.41
191 0.46
192 0.49
193 0.48
194 0.42
195 0.36
196 0.3
197 0.26
198 0.23
199 0.17
200 0.14
201 0.13
202 0.11
203 0.1
204 0.07
205 0.06
206 0.04
207 0.04
208 0.03
209 0.04
210 0.03
211 0.04
212 0.04
213 0.07
214 0.07
215 0.08
216 0.1
217 0.11
218 0.12
219 0.14
220 0.14
221 0.13
222 0.17
223 0.18
224 0.2
225 0.21
226 0.23
227 0.22
228 0.26
229 0.24
230 0.21
231 0.19
232 0.16
233 0.15
234 0.13
235 0.14
236 0.11
237 0.13
238 0.15
239 0.19
240 0.26
241 0.33
242 0.39
243 0.46
244 0.55
245 0.63
246 0.69
247 0.76
248 0.79
249 0.81
250 0.85
251 0.86
252 0.8