Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4KWI1

Protein Details
Accession A0A2S4KWI1   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
45-74LPLAAPLPKPRPKRRRRRRKSPTRIWVSVCHydrophilic
NLS Segment(s)
PositionSequence
52-66PKPRPKRRRRRRKSP
Subcellular Location(s) mito 12, nucl 5, cyto 4, plas 3, extr 1, pero 1, E.R. 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKSAWTSSSLSSRARTSTSSSPLAPRSSPPSHLVVLAVPPPLLVLPLAAPLPKPRPKRRRRRRKSPTRIWVSVCSTKQPLTRNLHGYDAPRFFPEKLRAGCASVLACLWRGRIGCSWKGCRTLIRSAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.3
4 0.33
5 0.36
6 0.36
7 0.35
8 0.38
9 0.39
10 0.4
11 0.35
12 0.31
13 0.34
14 0.33
15 0.35
16 0.33
17 0.33
18 0.31
19 0.3
20 0.27
21 0.2
22 0.18
23 0.16
24 0.14
25 0.1
26 0.09
27 0.09
28 0.08
29 0.07
30 0.05
31 0.04
32 0.04
33 0.05
34 0.06
35 0.06
36 0.06
37 0.09
38 0.17
39 0.24
40 0.32
41 0.42
42 0.53
43 0.63
44 0.74
45 0.82
46 0.87
47 0.9
48 0.93
49 0.94
50 0.94
51 0.95
52 0.94
53 0.93
54 0.9
55 0.84
56 0.75
57 0.69
58 0.63
59 0.59
60 0.48
61 0.41
62 0.34
63 0.33
64 0.34
65 0.33
66 0.35
67 0.36
68 0.4
69 0.42
70 0.42
71 0.42
72 0.4
73 0.39
74 0.37
75 0.32
76 0.28
77 0.25
78 0.26
79 0.24
80 0.28
81 0.32
82 0.33
83 0.33
84 0.36
85 0.36
86 0.35
87 0.35
88 0.3
89 0.25
90 0.17
91 0.16
92 0.12
93 0.13
94 0.12
95 0.12
96 0.14
97 0.14
98 0.16
99 0.22
100 0.28
101 0.33
102 0.4
103 0.47
104 0.49
105 0.53
106 0.53
107 0.53
108 0.52