Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4L7L2

Protein Details
Accession A0A2S4L7L2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
77-96ATRNCKTVPRRPRNPADFRAHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 21, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR010636  Cerato-ulmin_hydrophobin  
IPR036686  Hydrophobin_sf  
Gene Ontology GO:0005576  C:extracellular region  
GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF06766  Hydrophobin_2  
CDD cd23508  hydrophobin_II  
Amino Acid Sequences MTVTSPASQDFASPRAFDTDTVPLFHHQPTDNMKFWEFCVATILAAAAAGVAFAGPSVCRGIYGSAKCCDADDYGVATRNCKTVPRRPRNPADFRAMCASGGMTPWCCVLPVPGRVLCKKPKGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.21
3 0.22
4 0.2
5 0.21
6 0.25
7 0.24
8 0.25
9 0.25
10 0.23
11 0.24
12 0.24
13 0.24
14 0.18
15 0.22
16 0.28
17 0.32
18 0.33
19 0.33
20 0.33
21 0.3
22 0.3
23 0.33
24 0.25
25 0.19
26 0.19
27 0.17
28 0.16
29 0.15
30 0.15
31 0.06
32 0.06
33 0.06
34 0.02
35 0.02
36 0.02
37 0.02
38 0.01
39 0.01
40 0.02
41 0.02
42 0.02
43 0.03
44 0.04
45 0.04
46 0.04
47 0.05
48 0.07
49 0.11
50 0.13
51 0.16
52 0.16
53 0.17
54 0.17
55 0.17
56 0.16
57 0.12
58 0.11
59 0.09
60 0.1
61 0.11
62 0.16
63 0.16
64 0.16
65 0.16
66 0.17
67 0.17
68 0.2
69 0.25
70 0.3
71 0.41
72 0.51
73 0.59
74 0.66
75 0.76
76 0.8
77 0.82
78 0.78
79 0.76
80 0.67
81 0.6
82 0.57
83 0.48
84 0.38
85 0.3
86 0.25
87 0.16
88 0.16
89 0.15
90 0.1
91 0.1
92 0.11
93 0.11
94 0.11
95 0.1
96 0.15
97 0.2
98 0.22
99 0.27
100 0.3
101 0.36
102 0.4
103 0.48
104 0.51