FuNGI

A0A2S4KX58

Protein Details

Accession

A0A2S4KX58

Localization Confidence

Medium

Confidence Score

10.1

NoLS Segment(s)

Position	Sequence	Protein Nature
7-36	KPMATLQLEKRQQKRAKKAAQEKARQEKAA	Hydrophilic

NLS Segment(s)

Position	Sequence
16-49	KRQQKRAKKAAQEKARQEKAAAGPAPKKPAPAAK

Subcellular Location(s)

cyto 13.5, cyto_nucl 11, nucl 7.5, mito 4

Family & Domain DBs

InterPro	View protein in InterPro IPR001412 aa-tRNA-synth_I_CS IPR004514 Gln-tRNA-synth IPR000924 Glu/Gln-tRNA-synth IPR020058 Glu/Gln-tRNA-synth_Ib_cat-dom IPR020059 Glu/Gln-tRNA-synth_Ib_codon-bd IPR020056 Rbsml_L25/Gln-tRNA_synth_N IPR011035 Ribosomal_L25/Gln-tRNA_synth IPR014729 Rossmann-like_a/b/a_fold
Gene Ontology	GO:0005737 C:cytoplasm GO:0005524 F:ATP binding GO:0004819 F:glutamine-tRNA ligase activity GO:0006425 P:glutaminyl-tRNA aminoacylation
Pfam	View protein in Pfam PF00749 tRNA-synt_1c PF03950 tRNA-synt_1c_C
PROSITE	View protein in PROSITE PS00178 AA_TRNA_LIGASE_I
CDD	cd00807 GlnRS_core

Amino Acid Sequences

MTDDVTKPMATLQLEKRQQKRAKKAAQEKARQEKAAAGPAPKKPAPAAKPEEQPIDPDAMFKQGFLDDVYNERPDKNVVTRFPPEPNGYLHIGHAKAIAVNFGFAKHHGGVCYLRYDDTNPEKEEEEYFTAIQDMVRWLGFEPFKITYSSDNFEKLYQMAEKLVTLSKAYVCACTDVEIKLQRGGEKGAQPRYRCRHAEQSVEDNLTKFRDMRDGKRKPQMWDLAAYRIKTDTPHHRTGWDWKIYPTYDFTHCLCDSFEGITHSLCTTEFILSRVSYEWLNKSLEVYEPMQREYGRLNLTGTVLSKRKILKLVEENIVRDWDDPRLYTLIGIRRRGVPPGAILEFVNELGVTTNITTIQIQRFEQSIRKYLEKTVPRLMMILDPVPLVIEDAEAVDVELPFSPKDPKVGSHTVKFTPTVYIDRADFREVDSKDYFRLAPGKTVGLLNTPFPVKATSFTKDEATGKVTEIRGVFDKETKKAKTYIQWVGTEGSRKVEARIHNPLFKSEKPSDAEGGFLNDLDPDSEVVYPEALIESGFDEVKRRAPWPEAAGESELGKGGPESVRFQAMRVAYFAMDSDSTDDKIVLNRIVSLKEDAGKKQ

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.48
2	0.57
3	0.62
4	0.68
5	0.75
6	0.78
7	0.81
8	0.81
9	0.82
10	0.85
11	0.89
12	0.89
13	0.91
14	0.9
15	0.89
16	0.89
17	0.87
18	0.77
19	0.67
20	0.64
21	0.59
22	0.57
23	0.51
24	0.47
25	0.46
26	0.5
27	0.57
28	0.5
29	0.47
30	0.43
31	0.49
32	0.47
33	0.51
34	0.53
35	0.53
36	0.59
37	0.61
38	0.63
39	0.53
40	0.51
41	0.43
42	0.41
43	0.33
44	0.28
45	0.24
46	0.24
47	0.23
48	0.2
49	0.2
50	0.15
51	0.16
52	0.16
53	0.17
54	0.12
55	0.17
56	0.2
57	0.22
58	0.23
59	0.22
60	0.22
61	0.23
62	0.26
63	0.3
64	0.34
65	0.34
66	0.4
67	0.44
68	0.46
69	0.48
70	0.49
71	0.45
72	0.4
73	0.4
74	0.37
75	0.35
76	0.32
77	0.3
78	0.29
79	0.26
80	0.24
81	0.22
82	0.18
83	0.17
84	0.16
85	0.16
86	0.11
87	0.11
88	0.11
89	0.11
90	0.12
91	0.11
92	0.16
93	0.15
94	0.16
95	0.16
96	0.18
97	0.19
98	0.2
99	0.23
100	0.19
101	0.18
102	0.18
103	0.2
104	0.25
105	0.31
106	0.35
107	0.33
108	0.34
109	0.34
110	0.35
111	0.34
112	0.3
113	0.26
114	0.22
115	0.2
116	0.18
117	0.18
118	0.16
119	0.14
120	0.12
121	0.1
122	0.09
123	0.09
124	0.09
125	0.09
126	0.15
127	0.15
128	0.14
129	0.17
130	0.17
131	0.19
132	0.19
133	0.2
134	0.19
135	0.23
136	0.26
137	0.24
138	0.24
139	0.24
140	0.24
141	0.24
142	0.19
143	0.18
144	0.15
145	0.14
146	0.14
147	0.13
148	0.13
149	0.13
150	0.14
151	0.12
152	0.11
153	0.12
154	0.11
155	0.14
156	0.14
157	0.15
158	0.14
159	0.15
160	0.15
161	0.16
162	0.17
163	0.14
164	0.18
165	0.2
166	0.2
167	0.21
168	0.22
169	0.21
170	0.21
171	0.23
172	0.23
173	0.26
174	0.31
175	0.37
176	0.41
177	0.42
178	0.5
179	0.55
180	0.58
181	0.56
182	0.54
183	0.56
184	0.56
185	0.61
186	0.56
187	0.55
188	0.5
189	0.49
190	0.44
191	0.34
192	0.31
193	0.24
194	0.21
195	0.15
196	0.12
197	0.19
198	0.23
199	0.32
200	0.42
201	0.49
202	0.55
203	0.64
204	0.67
205	0.61
206	0.66
207	0.63
208	0.53
209	0.51
210	0.46
211	0.45
212	0.43
213	0.4
214	0.32
215	0.26
216	0.25
217	0.21
218	0.25
219	0.27
220	0.32
221	0.38
222	0.38
223	0.38
224	0.4
225	0.47
226	0.49
227	0.43
228	0.37
229	0.32
230	0.36
231	0.35
232	0.34
233	0.28
234	0.24
235	0.21
236	0.23
237	0.22
238	0.24
239	0.23
240	0.23
241	0.2
242	0.18
243	0.16
244	0.14
245	0.14
246	0.1
247	0.1
248	0.1
249	0.1
250	0.09
251	0.08
252	0.08
253	0.08
254	0.07
255	0.08
256	0.08
257	0.09
258	0.1
259	0.1
260	0.1
261	0.1
262	0.1
263	0.1
264	0.11
265	0.12
266	0.13
267	0.14
268	0.13
269	0.13
270	0.13
271	0.13
272	0.13
273	0.13
274	0.16
275	0.16
276	0.17
277	0.17
278	0.17
279	0.17
280	0.15
281	0.18
282	0.14
283	0.14
284	0.14
285	0.13
286	0.14
287	0.13
288	0.13
289	0.13
290	0.13
291	0.13
292	0.16
293	0.17
294	0.19
295	0.23
296	0.23
297	0.25
298	0.3
299	0.34
300	0.36
301	0.36
302	0.34
303	0.3
304	0.3
305	0.24
306	0.18
307	0.15
308	0.11
309	0.11
310	0.1
311	0.11
312	0.11
313	0.11
314	0.11
315	0.13
316	0.18
317	0.22
318	0.23
319	0.23
320	0.26
321	0.27
322	0.28
323	0.25
324	0.19
325	0.16
326	0.18
327	0.18
328	0.14
329	0.13
330	0.12
331	0.12
332	0.11
333	0.09
334	0.05
335	0.05
336	0.05
337	0.05
338	0.04
339	0.04
340	0.04
341	0.04
342	0.05
343	0.06
344	0.08
345	0.1
346	0.12
347	0.13
348	0.14
349	0.15
350	0.16
351	0.21
352	0.21
353	0.26
354	0.26
355	0.29
356	0.29
357	0.32
358	0.39
359	0.39
360	0.41
361	0.41
362	0.39
363	0.37
364	0.36
365	0.31
366	0.25
367	0.21
368	0.17
369	0.11
370	0.09
371	0.08
372	0.08
373	0.07
374	0.06
375	0.04
376	0.04
377	0.03
378	0.04
379	0.04
380	0.04
381	0.04
382	0.04
383	0.04
384	0.04
385	0.05
386	0.06
387	0.06
388	0.07
389	0.11
390	0.11
391	0.14
392	0.15
393	0.18
394	0.24
395	0.33
396	0.36
397	0.37
398	0.41
399	0.39
400	0.4
401	0.38
402	0.32
403	0.26
404	0.24
405	0.23
406	0.2
407	0.2
408	0.19
409	0.22
410	0.23
411	0.21
412	0.19
413	0.18
414	0.24
415	0.23
416	0.27
417	0.26
418	0.25
419	0.25
420	0.27
421	0.25
422	0.19
423	0.25
424	0.2
425	0.22
426	0.22
427	0.22
428	0.21
429	0.22
430	0.2
431	0.18
432	0.18
433	0.15
434	0.16
435	0.15
436	0.14
437	0.14
438	0.16
439	0.12
440	0.16
441	0.2
442	0.21
443	0.23
444	0.24
445	0.25
446	0.27
447	0.28
448	0.25
449	0.24
450	0.21
451	0.2
452	0.24
453	0.22
454	0.22
455	0.21
456	0.21
457	0.21
458	0.23
459	0.24
460	0.25
461	0.29
462	0.31
463	0.39
464	0.39
465	0.39
466	0.4
467	0.44
468	0.46
469	0.5
470	0.53
471	0.5
472	0.49
473	0.47
474	0.46
475	0.43
476	0.4
477	0.32
478	0.26
479	0.24
480	0.23
481	0.24
482	0.28
483	0.31
484	0.33
485	0.43
486	0.45
487	0.47
488	0.47
489	0.51
490	0.51
491	0.49
492	0.5
493	0.43
494	0.44
495	0.42
496	0.44
497	0.42
498	0.36
499	0.35
500	0.27
501	0.28
502	0.21
503	0.18
504	0.15
505	0.11
506	0.11
507	0.1
508	0.1
509	0.07
510	0.08
511	0.08
512	0.09
513	0.09
514	0.09
515	0.08
516	0.08
517	0.08
518	0.07
519	0.06
520	0.06
521	0.06
522	0.07
523	0.08
524	0.08
525	0.12
526	0.13
527	0.19
528	0.22
529	0.23
530	0.26
531	0.3
532	0.36
533	0.37
534	0.41
535	0.38
536	0.38
537	0.38
538	0.34
539	0.3
540	0.25
541	0.2
542	0.15
543	0.12
544	0.09
545	0.1
546	0.12
547	0.14
548	0.18
549	0.2
550	0.27
551	0.27
552	0.27
553	0.3
554	0.29
555	0.28
556	0.25
557	0.25
558	0.18
559	0.18
560	0.18
561	0.15
562	0.13
563	0.12
564	0.15
565	0.15
566	0.16
567	0.17
568	0.17
569	0.15
570	0.19
571	0.22
572	0.2
573	0.19
574	0.22
575	0.24
576	0.26
577	0.27
578	0.27
579	0.27
580	0.3

A0A2S4KX58

3D AlphaFold-predicted Structure Viewer