Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J7RZ94

Protein Details
Accession J7RZ94   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
357-380AAAARAKAARKTTKKNGKVTKARRHydrophilic
NLS Segment(s)
PositionSequence
358-380AAARAKAARKTTKKNGKVTKARR
Subcellular Location(s) mito 18.5, cyto_mito 11.5, cyto 3.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036279  5-3_exonuclease_C_sf  
IPR023426  Flap_endonuc  
IPR008918  HhH2  
IPR029060  PIN-like_dom_sf  
IPR006086  XPG-I_dom  
IPR006084  XPG/Rad2  
IPR019974  XPG_CS  
IPR006085  XPG_DNA_repair_N  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0005730  C:nucleolus  
GO:0005654  C:nucleoplasm  
GO:0008409  F:5'-3' exonuclease activity  
GO:0017108  F:5'-flap endonuclease activity  
GO:0003677  F:DNA binding  
GO:0000287  F:magnesium ion binding  
GO:0006284  P:base-excision repair  
GO:0043137  P:DNA replication, removal of RNA primer  
Pfam View protein in Pfam  
PF00867  XPG_I  
PF00752  XPG_N  
PROSITE View protein in PROSITE  
PS00841  XPG_1  
PS00842  XPG_2  
CDD cd09867  PIN_FEN1  
Amino Acid Sequences MGIKGLNGIIMESAPLAVRRSEMKAFFGRKVAIDASMSLYQFLIAVRQQDGGQLTDAEGGTTSHLMGMFYRTLRMVDNGIKPCYVFDGAPPALKQHELGKRTQRRAETEQRLKEATDLAEKAKQERRLVKVSKEHNEEAKKLLGLMGVPYVDAPGEAEAQCAELAKGGKVYAAASEDMDTLCYKTPYLLRHLTFSEAKKEPVQEIDTLAVLDAMELTIEQFVDLGIMLGCDYCESIRGVGPVTALKLIREHKSLEGIVQYIDSGSNEKWKVPENWPYKEVRKLFLDPDVTPASEITLKWEPPQEEELVKYLCGEKLFSEERVRSGVKRLRAGLKSGVQGRLDGFFKVVPKTKEQQAAAAARAKAARKTTKKNGKVTKARR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.09
3 0.1
4 0.1
5 0.12
6 0.15
7 0.2
8 0.26
9 0.27
10 0.32
11 0.39
12 0.43
13 0.44
14 0.45
15 0.42
16 0.36
17 0.38
18 0.34
19 0.27
20 0.23
21 0.21
22 0.22
23 0.23
24 0.22
25 0.18
26 0.17
27 0.15
28 0.15
29 0.14
30 0.12
31 0.1
32 0.12
33 0.13
34 0.15
35 0.15
36 0.18
37 0.19
38 0.17
39 0.17
40 0.15
41 0.14
42 0.16
43 0.15
44 0.12
45 0.11
46 0.1
47 0.1
48 0.1
49 0.09
50 0.07
51 0.08
52 0.08
53 0.08
54 0.11
55 0.12
56 0.12
57 0.14
58 0.13
59 0.14
60 0.15
61 0.16
62 0.17
63 0.21
64 0.28
65 0.32
66 0.33
67 0.32
68 0.31
69 0.29
70 0.28
71 0.24
72 0.16
73 0.12
74 0.19
75 0.2
76 0.22
77 0.22
78 0.2
79 0.2
80 0.2
81 0.2
82 0.2
83 0.27
84 0.27
85 0.34
86 0.43
87 0.51
88 0.57
89 0.62
90 0.59
91 0.59
92 0.65
93 0.69
94 0.69
95 0.69
96 0.67
97 0.65
98 0.61
99 0.53
100 0.46
101 0.38
102 0.29
103 0.24
104 0.2
105 0.19
106 0.22
107 0.22
108 0.26
109 0.3
110 0.34
111 0.35
112 0.41
113 0.44
114 0.5
115 0.54
116 0.55
117 0.57
118 0.59
119 0.61
120 0.6
121 0.57
122 0.56
123 0.56
124 0.5
125 0.45
126 0.39
127 0.3
128 0.24
129 0.22
130 0.15
131 0.11
132 0.1
133 0.08
134 0.06
135 0.06
136 0.06
137 0.05
138 0.05
139 0.04
140 0.04
141 0.04
142 0.06
143 0.06
144 0.06
145 0.06
146 0.07
147 0.07
148 0.07
149 0.06
150 0.06
151 0.07
152 0.07
153 0.07
154 0.07
155 0.07
156 0.07
157 0.07
158 0.06
159 0.07
160 0.07
161 0.07
162 0.07
163 0.07
164 0.07
165 0.08
166 0.07
167 0.06
168 0.07
169 0.07
170 0.06
171 0.08
172 0.11
173 0.12
174 0.18
175 0.22
176 0.22
177 0.24
178 0.25
179 0.27
180 0.27
181 0.27
182 0.28
183 0.24
184 0.25
185 0.24
186 0.25
187 0.22
188 0.21
189 0.21
190 0.15
191 0.15
192 0.14
193 0.12
194 0.11
195 0.1
196 0.07
197 0.05
198 0.04
199 0.03
200 0.02
201 0.02
202 0.02
203 0.02
204 0.03
205 0.03
206 0.03
207 0.03
208 0.03
209 0.03
210 0.03
211 0.03
212 0.03
213 0.03
214 0.03
215 0.03
216 0.03
217 0.03
218 0.03
219 0.03
220 0.04
221 0.05
222 0.06
223 0.07
224 0.07
225 0.08
226 0.08
227 0.09
228 0.09
229 0.09
230 0.11
231 0.1
232 0.1
233 0.14
234 0.17
235 0.19
236 0.21
237 0.22
238 0.21
239 0.24
240 0.24
241 0.21
242 0.18
243 0.16
244 0.14
245 0.12
246 0.11
247 0.07
248 0.08
249 0.07
250 0.08
251 0.07
252 0.14
253 0.15
254 0.16
255 0.17
256 0.22
257 0.26
258 0.3
259 0.39
260 0.39
261 0.44
262 0.46
263 0.5
264 0.5
265 0.54
266 0.51
267 0.45
268 0.43
269 0.41
270 0.4
271 0.41
272 0.4
273 0.32
274 0.35
275 0.32
276 0.27
277 0.24
278 0.22
279 0.18
280 0.16
281 0.16
282 0.17
283 0.19
284 0.2
285 0.22
286 0.28
287 0.27
288 0.28
289 0.32
290 0.28
291 0.25
292 0.26
293 0.28
294 0.23
295 0.22
296 0.19
297 0.18
298 0.17
299 0.17
300 0.16
301 0.13
302 0.18
303 0.21
304 0.23
305 0.28
306 0.27
307 0.29
308 0.33
309 0.34
310 0.29
311 0.37
312 0.39
313 0.39
314 0.44
315 0.47
316 0.51
317 0.52
318 0.54
319 0.52
320 0.51
321 0.51
322 0.5
323 0.49
324 0.41
325 0.4
326 0.37
327 0.34
328 0.3
329 0.24
330 0.2
331 0.17
332 0.2
333 0.25
334 0.3
335 0.29
336 0.35
337 0.41
338 0.47
339 0.53
340 0.51
341 0.5
342 0.51
343 0.52
344 0.49
345 0.49
346 0.42
347 0.36
348 0.4
349 0.38
350 0.36
351 0.4
352 0.47
353 0.5
354 0.6
355 0.68
356 0.75
357 0.8
358 0.85
359 0.87
360 0.88