Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4PXG2

Protein Details
Accession A0A2S4PXG2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
168-187AYRIARCTNSLRNKNRVSRSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12.833, nucl 12.5, cyto 10, cyto_mito 6.999
Family & Domain DBs
InterPro View protein in InterPro  
IPR036691  Endo/exonu/phosph_ase_sf  
IPR005135  Endo/exonuclease/phosphatase  
Gene Ontology GO:0003824  F:catalytic activity  
Pfam View protein in Pfam  
PF14529  Exo_endo_phos_2  
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MAGLSRIWNIYNAPLGSDETGNGLTTLLSCNNTLYFVGGDYNLQHALLDLDVDHPQATSQAFIDWHSSRGLKLLNPTETPTHNCSGTLDLSFSTDNKARCEVSILFRETSIQDPGNFRYDAFDETELEVEAKDIIEIITAFSGSCPRTKANKAGISWWNEECKQASRAYRIARCTNSLRNKNRVSRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.2
4 0.19
5 0.16
6 0.13
7 0.14
8 0.13
9 0.12
10 0.1
11 0.08
12 0.08
13 0.1
14 0.1
15 0.1
16 0.11
17 0.12
18 0.12
19 0.13
20 0.12
21 0.11
22 0.1
23 0.09
24 0.1
25 0.09
26 0.09
27 0.08
28 0.1
29 0.09
30 0.09
31 0.08
32 0.07
33 0.08
34 0.07
35 0.06
36 0.05
37 0.06
38 0.07
39 0.07
40 0.07
41 0.06
42 0.07
43 0.08
44 0.08
45 0.07
46 0.06
47 0.07
48 0.08
49 0.09
50 0.14
51 0.13
52 0.14
53 0.15
54 0.15
55 0.14
56 0.16
57 0.16
58 0.12
59 0.17
60 0.21
61 0.22
62 0.22
63 0.24
64 0.24
65 0.25
66 0.28
67 0.26
68 0.23
69 0.2
70 0.19
71 0.18
72 0.18
73 0.17
74 0.13
75 0.1
76 0.08
77 0.09
78 0.1
79 0.09
80 0.09
81 0.11
82 0.12
83 0.13
84 0.15
85 0.14
86 0.14
87 0.18
88 0.17
89 0.18
90 0.22
91 0.23
92 0.21
93 0.21
94 0.22
95 0.19
96 0.19
97 0.18
98 0.14
99 0.13
100 0.15
101 0.17
102 0.2
103 0.19
104 0.17
105 0.16
106 0.17
107 0.17
108 0.17
109 0.15
110 0.13
111 0.14
112 0.14
113 0.12
114 0.11
115 0.09
116 0.07
117 0.07
118 0.05
119 0.04
120 0.04
121 0.04
122 0.04
123 0.04
124 0.05
125 0.05
126 0.05
127 0.05
128 0.05
129 0.09
130 0.09
131 0.11
132 0.13
133 0.17
134 0.24
135 0.29
136 0.36
137 0.42
138 0.48
139 0.47
140 0.53
141 0.55
142 0.53
143 0.52
144 0.48
145 0.44
146 0.38
147 0.39
148 0.35
149 0.33
150 0.3
151 0.32
152 0.34
153 0.35
154 0.41
155 0.47
156 0.5
157 0.53
158 0.58
159 0.56
160 0.56
161 0.57
162 0.61
163 0.63
164 0.68
165 0.69
166 0.71
167 0.76