Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2S4PQY2

Protein Details
Accession A0A2S4PQY2    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
159-179AKDLKFPLPHRVPKNNSRNLFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 13.333, mito 13, nucl 11.5, cyto_nucl 7.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR028877  50S_L18Ae/Ribosomal_L18a/L20  
IPR023573  Ribosomal_L18a//L18Ae/LX  
IPR021138  Ribosomal_L18a/L20_eukaryotes  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01775  Ribosomal_L18A  
Amino Acid Sequences MRKSATTNYDNGRPDRRLIEYQVIGRHLPTDTNPTPKLYRMRIFAPNTVVAKSRFWYFLMKLRKVKKSNGEIVSLNVISEKRPTKVKNFGIWIRYDSRSGTHNMYKEYREMSRTDAVEALYQDMAARHRSRFRSIHVLKVVELEKTNDVKRPYIKQLLAKDLKFPLPHRVPKNNSRNLFASKRPSTFQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.46
3 0.46
4 0.44
5 0.44
6 0.47
7 0.43
8 0.45
9 0.45
10 0.43
11 0.38
12 0.33
13 0.3
14 0.22
15 0.2
16 0.17
17 0.23
18 0.24
19 0.3
20 0.32
21 0.34
22 0.35
23 0.4
24 0.45
25 0.43
26 0.44
27 0.41
28 0.44
29 0.49
30 0.5
31 0.48
32 0.45
33 0.42
34 0.39
35 0.36
36 0.34
37 0.27
38 0.25
39 0.23
40 0.22
41 0.18
42 0.18
43 0.21
44 0.21
45 0.27
46 0.34
47 0.39
48 0.44
49 0.51
50 0.59
51 0.58
52 0.63
53 0.64
54 0.62
55 0.65
56 0.6
57 0.55
58 0.46
59 0.44
60 0.4
61 0.3
62 0.23
63 0.15
64 0.13
65 0.1
66 0.14
67 0.15
68 0.14
69 0.2
70 0.22
71 0.27
72 0.36
73 0.4
74 0.41
75 0.44
76 0.46
77 0.42
78 0.41
79 0.38
80 0.32
81 0.29
82 0.25
83 0.2
84 0.17
85 0.17
86 0.18
87 0.2
88 0.19
89 0.2
90 0.23
91 0.25
92 0.24
93 0.24
94 0.24
95 0.22
96 0.2
97 0.2
98 0.21
99 0.23
100 0.22
101 0.21
102 0.19
103 0.18
104 0.18
105 0.17
106 0.14
107 0.1
108 0.09
109 0.08
110 0.08
111 0.09
112 0.13
113 0.14
114 0.16
115 0.23
116 0.26
117 0.33
118 0.35
119 0.38
120 0.45
121 0.45
122 0.5
123 0.48
124 0.46
125 0.4
126 0.42
127 0.38
128 0.29
129 0.27
130 0.21
131 0.21
132 0.24
133 0.26
134 0.26
135 0.27
136 0.31
137 0.35
138 0.39
139 0.42
140 0.47
141 0.49
142 0.52
143 0.55
144 0.61
145 0.62
146 0.56
147 0.53
148 0.49
149 0.49
150 0.46
151 0.42
152 0.42
153 0.45
154 0.53
155 0.57
156 0.63
157 0.67
158 0.73
159 0.82
160 0.81
161 0.75
162 0.72
163 0.68
164 0.66
165 0.65
166 0.61
167 0.61
168 0.58