Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4Q157

Protein Details
Accession A0A2S4Q157    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
4-29SLEAHPKADNKKKRKAFVPIENNPEVHydrophilic
NLS Segment(s)
PositionSequence
14-17KKKR
Subcellular Location(s) nucl 14, cyto_nucl 10.5, cyto 5, mito 3, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR038765  Papain-like_cys_pep_sf  
IPR001578  Peptidase_C12_UCH  
IPR036959  Peptidase_C12_UCH_sf  
Gene Ontology GO:0004843  F:cysteine-type deubiquitinase activity  
GO:0006511  P:ubiquitin-dependent protein catabolic process  
Pfam View protein in Pfam  
PF01088  Peptidase_C12  
PROSITE View protein in PROSITE  
PS00140  UCH_1  
CDD cd09616  Peptidase_C12_UCH_L1_L3  
Amino Acid Sequences MSSSLEAHPKADNKKKRKAFVPIENNPEVLSALSYSLGLSSELSFYDVFSIEDADLLAFIPRPAIALLLVFPVSKAYEEFRLYEEQNDLNYDKASQDIIWYKQTIHNSCGIMAILHALSNGEPRKFIKPNSDLDKLIKKAIPLGPDERAELVYNFEAIETAHEDAACQGQSPAPKAEEELDLHYVCFTKGEDNVLWELDGRRKGPLNRGKLGAKDDLLSEKSLELSVRSFLKREETAGNGEIRFSLMVLAPNSKTDSEAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.77
3 0.8
4 0.81
5 0.82
6 0.82
7 0.82
8 0.84
9 0.81
10 0.8
11 0.74
12 0.66
13 0.55
14 0.45
15 0.35
16 0.24
17 0.17
18 0.09
19 0.08
20 0.08
21 0.08
22 0.07
23 0.07
24 0.07
25 0.07
26 0.07
27 0.07
28 0.07
29 0.08
30 0.09
31 0.09
32 0.08
33 0.09
34 0.09
35 0.08
36 0.08
37 0.09
38 0.07
39 0.08
40 0.08
41 0.06
42 0.05
43 0.05
44 0.06
45 0.05
46 0.05
47 0.05
48 0.05
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.06
55 0.07
56 0.07
57 0.06
58 0.06
59 0.07
60 0.07
61 0.07
62 0.08
63 0.09
64 0.13
65 0.15
66 0.16
67 0.17
68 0.2
69 0.21
70 0.21
71 0.21
72 0.18
73 0.17
74 0.19
75 0.17
76 0.14
77 0.14
78 0.12
79 0.1
80 0.1
81 0.1
82 0.07
83 0.1
84 0.13
85 0.15
86 0.16
87 0.17
88 0.18
89 0.21
90 0.27
91 0.26
92 0.24
93 0.26
94 0.24
95 0.24
96 0.23
97 0.19
98 0.13
99 0.1
100 0.1
101 0.05
102 0.05
103 0.04
104 0.04
105 0.04
106 0.09
107 0.11
108 0.1
109 0.11
110 0.13
111 0.19
112 0.21
113 0.23
114 0.27
115 0.29
116 0.35
117 0.4
118 0.42
119 0.37
120 0.38
121 0.42
122 0.35
123 0.34
124 0.28
125 0.22
126 0.23
127 0.24
128 0.23
129 0.2
130 0.21
131 0.22
132 0.21
133 0.22
134 0.18
135 0.16
136 0.15
137 0.13
138 0.12
139 0.09
140 0.09
141 0.08
142 0.07
143 0.06
144 0.06
145 0.07
146 0.06
147 0.07
148 0.07
149 0.07
150 0.07
151 0.08
152 0.09
153 0.08
154 0.06
155 0.06
156 0.08
157 0.1
158 0.12
159 0.14
160 0.13
161 0.13
162 0.14
163 0.16
164 0.17
165 0.16
166 0.17
167 0.18
168 0.17
169 0.17
170 0.17
171 0.15
172 0.12
173 0.12
174 0.09
175 0.08
176 0.09
177 0.13
178 0.13
179 0.15
180 0.16
181 0.16
182 0.15
183 0.14
184 0.15
185 0.17
186 0.2
187 0.19
188 0.21
189 0.26
190 0.3
191 0.38
192 0.45
193 0.47
194 0.48
195 0.52
196 0.53
197 0.51
198 0.52
199 0.45
200 0.38
201 0.31
202 0.28
203 0.28
204 0.26
205 0.23
206 0.19
207 0.16
208 0.16
209 0.16
210 0.15
211 0.11
212 0.11
213 0.14
214 0.18
215 0.19
216 0.2
217 0.21
218 0.27
219 0.27
220 0.29
221 0.29
222 0.28
223 0.31
224 0.33
225 0.35
226 0.28
227 0.27
228 0.24
229 0.21
230 0.17
231 0.13
232 0.11
233 0.09
234 0.13
235 0.15
236 0.19
237 0.19
238 0.21
239 0.24
240 0.23