Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4PQA2

Protein Details
Accession A0A2S4PQA2    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MPQKQSVKNGKTARHKKRKPRTEVSSSESHydrophilic
NLS Segment(s)
PositionSequence
9-21NGKTARHKKRKPR
Subcellular Location(s) nucl 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR028217  Rsa3_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF14615  Rsa3  
Amino Acid Sequences MPQKQSVKNGKTARHKKRKPRTEVSSSESSDNDCEPTNSSQVENEEKVDKKRENLELPKLCVTKKKLSKSKTDDEVSAAFAEFYLKKVTNEFSDDLDQLRNADDFKEDSIPILISALQQGTSLFSIEEQRRIVLAGQEIEEEKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.85
3 0.87
4 0.91
5 0.93
6 0.91
7 0.91
8 0.89
9 0.87
10 0.84
11 0.79
12 0.76
13 0.67
14 0.59
15 0.49
16 0.42
17 0.34
18 0.28
19 0.22
20 0.15
21 0.14
22 0.15
23 0.17
24 0.18
25 0.17
26 0.17
27 0.17
28 0.2
29 0.23
30 0.21
31 0.2
32 0.23
33 0.24
34 0.27
35 0.32
36 0.31
37 0.3
38 0.35
39 0.39
40 0.42
41 0.45
42 0.52
43 0.49
44 0.5
45 0.52
46 0.47
47 0.42
48 0.4
49 0.4
50 0.39
51 0.43
52 0.5
53 0.52
54 0.55
55 0.64
56 0.65
57 0.66
58 0.64
59 0.58
60 0.48
61 0.43
62 0.4
63 0.31
64 0.24
65 0.17
66 0.1
67 0.08
68 0.09
69 0.07
70 0.07
71 0.09
72 0.1
73 0.1
74 0.12
75 0.14
76 0.14
77 0.18
78 0.18
79 0.18
80 0.19
81 0.19
82 0.19
83 0.18
84 0.16
85 0.13
86 0.12
87 0.1
88 0.08
89 0.09
90 0.09
91 0.09
92 0.11
93 0.13
94 0.12
95 0.12
96 0.13
97 0.13
98 0.11
99 0.1
100 0.09
101 0.07
102 0.08
103 0.08
104 0.07
105 0.07
106 0.07
107 0.09
108 0.09
109 0.09
110 0.08
111 0.09
112 0.16
113 0.18
114 0.23
115 0.22
116 0.22
117 0.22
118 0.23
119 0.23
120 0.19
121 0.21
122 0.19
123 0.19
124 0.2