Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4PJ46

Protein Details
Accession A0A2S4PJ46    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
79-102IEKEILKNEKNRHRNKRKEFLDAGBasic
123-148SSNGAVEKRKHSHRKRFNLNQSKSTTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 5, cyto 2.5, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR017850  Alkaline_phosphatase_core_sf  
IPR002591  Phosphodiest/P_Trfase  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF01663  Phosphodiest  
CDD cd16018  Enpp  
Amino Acid Sequences MIVRRDQKNEMEDDLASVEGRISHEIQAHDYDTIRHEEELEQLLMQNSQDDNSTSVLTQKDLNTLFPRNKLNLHQDELIEKEILKNEKNRHRNKRKEFLDAGQNSEEEVELLFEIEEGVLTDSSNGAVEKRKHSHRKRFNLNQSKSTTTIWQTKYFISCLVTIGLFTFLLLTLKLKLKSKGPQLITKMKSNGTTLFAPTTILISLDGFRPDFLNRGITPRLNAMRDEGFAPAYMLPSFPSVTFPNHYTLVTGLYPESHGIVSNLFWDDDLKEKFYYTEPDAMNKKWWGGEPIWVTAEKQGVKTAVHMWPGSEAHIMDIEPTYLDKFNYKTTIKEKTDRVLELLDKGASQDCSDQVSRPQLIAAYVPHVDIDGHFYGPNTTEIRSTISDADNMLNEIYLGLERRNLTDIVNIVVVSDHGMATTDIDRMIQLDDLLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.23
3 0.18
4 0.14
5 0.11
6 0.1
7 0.11
8 0.13
9 0.14
10 0.17
11 0.21
12 0.22
13 0.25
14 0.26
15 0.26
16 0.24
17 0.23
18 0.22
19 0.21
20 0.24
21 0.23
22 0.2
23 0.2
24 0.2
25 0.23
26 0.25
27 0.22
28 0.18
29 0.18
30 0.18
31 0.17
32 0.16
33 0.15
34 0.12
35 0.11
36 0.13
37 0.12
38 0.13
39 0.14
40 0.15
41 0.12
42 0.16
43 0.16
44 0.16
45 0.19
46 0.18
47 0.23
48 0.23
49 0.27
50 0.28
51 0.35
52 0.38
53 0.4
54 0.44
55 0.4
56 0.44
57 0.46
58 0.51
59 0.5
60 0.5
61 0.47
62 0.43
63 0.43
64 0.41
65 0.36
66 0.27
67 0.21
68 0.19
69 0.21
70 0.24
71 0.26
72 0.31
73 0.38
74 0.48
75 0.58
76 0.66
77 0.72
78 0.8
79 0.87
80 0.9
81 0.91
82 0.85
83 0.84
84 0.79
85 0.73
86 0.72
87 0.63
88 0.58
89 0.48
90 0.43
91 0.34
92 0.29
93 0.23
94 0.13
95 0.11
96 0.06
97 0.05
98 0.05
99 0.05
100 0.04
101 0.04
102 0.04
103 0.04
104 0.04
105 0.05
106 0.05
107 0.05
108 0.05
109 0.05
110 0.05
111 0.06
112 0.06
113 0.06
114 0.13
115 0.17
116 0.24
117 0.3
118 0.4
119 0.51
120 0.61
121 0.71
122 0.75
123 0.82
124 0.86
125 0.9
126 0.91
127 0.91
128 0.86
129 0.83
130 0.76
131 0.69
132 0.61
133 0.51
134 0.44
135 0.38
136 0.41
137 0.36
138 0.36
139 0.34
140 0.34
141 0.35
142 0.31
143 0.28
144 0.21
145 0.18
146 0.15
147 0.14
148 0.12
149 0.1
150 0.1
151 0.09
152 0.07
153 0.06
154 0.05
155 0.04
156 0.05
157 0.05
158 0.05
159 0.08
160 0.12
161 0.14
162 0.17
163 0.19
164 0.24
165 0.3
166 0.37
167 0.42
168 0.41
169 0.45
170 0.48
171 0.56
172 0.54
173 0.52
174 0.47
175 0.41
176 0.39
177 0.35
178 0.3
179 0.24
180 0.22
181 0.18
182 0.17
183 0.15
184 0.13
185 0.12
186 0.11
187 0.07
188 0.06
189 0.05
190 0.05
191 0.06
192 0.06
193 0.07
194 0.07
195 0.07
196 0.08
197 0.08
198 0.09
199 0.09
200 0.12
201 0.11
202 0.15
203 0.17
204 0.16
205 0.17
206 0.19
207 0.22
208 0.19
209 0.19
210 0.18
211 0.17
212 0.17
213 0.17
214 0.13
215 0.1
216 0.09
217 0.1
218 0.08
219 0.07
220 0.07
221 0.06
222 0.06
223 0.07
224 0.08
225 0.07
226 0.09
227 0.1
228 0.12
229 0.14
230 0.15
231 0.17
232 0.18
233 0.17
234 0.15
235 0.14
236 0.14
237 0.12
238 0.11
239 0.08
240 0.07
241 0.08
242 0.07
243 0.08
244 0.06
245 0.06
246 0.06
247 0.06
248 0.06
249 0.07
250 0.08
251 0.07
252 0.07
253 0.07
254 0.08
255 0.13
256 0.14
257 0.15
258 0.14
259 0.15
260 0.16
261 0.17
262 0.2
263 0.17
264 0.23
265 0.21
266 0.27
267 0.3
268 0.3
269 0.33
270 0.29
271 0.28
272 0.22
273 0.23
274 0.21
275 0.19
276 0.24
277 0.22
278 0.23
279 0.24
280 0.22
281 0.22
282 0.2
283 0.23
284 0.18
285 0.17
286 0.17
287 0.17
288 0.17
289 0.18
290 0.2
291 0.19
292 0.21
293 0.2
294 0.18
295 0.2
296 0.2
297 0.2
298 0.16
299 0.13
300 0.11
301 0.12
302 0.11
303 0.09
304 0.09
305 0.08
306 0.07
307 0.07
308 0.08
309 0.09
310 0.1
311 0.11
312 0.13
313 0.17
314 0.23
315 0.24
316 0.28
317 0.33
318 0.43
319 0.45
320 0.5
321 0.5
322 0.5
323 0.55
324 0.5
325 0.46
326 0.39
327 0.36
328 0.31
329 0.29
330 0.22
331 0.17
332 0.17
333 0.17
334 0.14
335 0.14
336 0.14
337 0.13
338 0.17
339 0.18
340 0.19
341 0.21
342 0.27
343 0.27
344 0.25
345 0.25
346 0.21
347 0.21
348 0.21
349 0.17
350 0.14
351 0.14
352 0.14
353 0.13
354 0.12
355 0.12
356 0.1
357 0.15
358 0.13
359 0.13
360 0.13
361 0.14
362 0.15
363 0.16
364 0.2
365 0.15
366 0.15
367 0.15
368 0.16
369 0.2
370 0.2
371 0.22
372 0.22
373 0.22
374 0.22
375 0.22
376 0.23
377 0.19
378 0.19
379 0.16
380 0.12
381 0.1
382 0.09
383 0.08
384 0.08
385 0.09
386 0.08
387 0.13
388 0.14
389 0.16
390 0.19
391 0.19
392 0.18
393 0.21
394 0.21
395 0.19
396 0.19
397 0.17
398 0.14
399 0.14
400 0.13
401 0.11
402 0.1
403 0.08
404 0.07
405 0.08
406 0.08
407 0.11
408 0.12
409 0.11
410 0.1
411 0.11
412 0.11
413 0.11
414 0.12
415 0.1