Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4PS62

Protein Details
Accession A0A2S4PS62   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
172-195DGSLCKKSHPRWPRNLPKATRRVIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 13.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045348  CPSF4/Yth1  
IPR000571  Znf_CCCH  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
GO:0003723  F:RNA binding  
GO:0098789  P:pre-mRNA cleavage required for polyadenylation  
PROSITE View protein in PROSITE  
PS50103  ZF_C3H1  
Amino Acid Sequences MVSSNPEPKELARQILDHQPLRFNFTFLPYLNQTFGFGLSPNRPVCKAYLQGHCPSGLSCPEKHNNNGPNFSNLVCKSVFTLISTGCEASVKREIVVSSYMNTTSEKCQSAISLLDMDVVPTECLYLHLDPSSKLPPCPHYEKGFCALGPLCSQRHVRKVICEFYLAGFCPDGSLCKKSHPRWPRNLPKATRRVIKTAEEIQEEQKVLIENAERELASEREKYGERGNENRGRGRWHSNGHNRGGNRGGNSNRRGRYN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.44
3 0.5
4 0.44
5 0.42
6 0.43
7 0.42
8 0.48
9 0.44
10 0.37
11 0.32
12 0.32
13 0.34
14 0.28
15 0.33
16 0.28
17 0.3
18 0.29
19 0.28
20 0.25
21 0.21
22 0.21
23 0.16
24 0.13
25 0.15
26 0.17
27 0.23
28 0.24
29 0.26
30 0.26
31 0.26
32 0.29
33 0.3
34 0.35
35 0.36
36 0.42
37 0.44
38 0.47
39 0.47
40 0.44
41 0.39
42 0.31
43 0.28
44 0.25
45 0.24
46 0.22
47 0.27
48 0.34
49 0.38
50 0.41
51 0.47
52 0.48
53 0.5
54 0.54
55 0.49
56 0.45
57 0.42
58 0.39
59 0.37
60 0.3
61 0.27
62 0.21
63 0.2
64 0.18
65 0.19
66 0.19
67 0.13
68 0.14
69 0.12
70 0.13
71 0.14
72 0.12
73 0.1
74 0.1
75 0.1
76 0.12
77 0.17
78 0.15
79 0.14
80 0.16
81 0.16
82 0.16
83 0.19
84 0.15
85 0.11
86 0.12
87 0.12
88 0.12
89 0.13
90 0.12
91 0.13
92 0.16
93 0.16
94 0.15
95 0.15
96 0.15
97 0.15
98 0.14
99 0.12
100 0.09
101 0.08
102 0.08
103 0.08
104 0.08
105 0.07
106 0.06
107 0.05
108 0.04
109 0.05
110 0.04
111 0.05
112 0.07
113 0.07
114 0.07
115 0.08
116 0.09
117 0.09
118 0.12
119 0.15
120 0.14
121 0.15
122 0.16
123 0.19
124 0.24
125 0.3
126 0.31
127 0.32
128 0.34
129 0.35
130 0.37
131 0.34
132 0.28
133 0.24
134 0.2
135 0.16
136 0.16
137 0.17
138 0.14
139 0.16
140 0.21
141 0.23
142 0.28
143 0.33
144 0.33
145 0.37
146 0.42
147 0.43
148 0.39
149 0.37
150 0.31
151 0.26
152 0.27
153 0.2
154 0.15
155 0.11
156 0.1
157 0.09
158 0.09
159 0.1
160 0.11
161 0.14
162 0.14
163 0.22
164 0.31
165 0.34
166 0.44
167 0.52
168 0.59
169 0.66
170 0.77
171 0.8
172 0.81
173 0.87
174 0.84
175 0.83
176 0.83
177 0.79
178 0.77
179 0.69
180 0.65
181 0.6
182 0.57
183 0.52
184 0.5
185 0.48
186 0.44
187 0.42
188 0.38
189 0.38
190 0.34
191 0.29
192 0.23
193 0.19
194 0.16
195 0.16
196 0.16
197 0.13
198 0.14
199 0.16
200 0.14
201 0.14
202 0.17
203 0.17
204 0.18
205 0.19
206 0.18
207 0.21
208 0.22
209 0.24
210 0.28
211 0.33
212 0.36
213 0.4
214 0.49
215 0.52
216 0.56
217 0.6
218 0.55
219 0.55
220 0.54
221 0.56
222 0.54
223 0.54
224 0.6
225 0.64
226 0.69
227 0.69
228 0.71
229 0.63
230 0.61
231 0.6
232 0.54
233 0.46
234 0.47
235 0.48
236 0.51
237 0.57
238 0.61