Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J7RT03

Protein Details
Accession J7RT03    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
97-121LPVRGQKTKNNAKTARKLNKLDRKGHydrophilic
NLS Segment(s)
PositionSequence
103-121KTKNNAKTARKLNKLDRKG
Subcellular Location(s) cyto 22, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR027437  30s_Rbsml_prot_S13_C  
IPR001892  Ribosomal_S13  
IPR010979  Ribosomal_S13-like_H2TH  
IPR018269  Ribosomal_S13_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00416  Ribosomal_S13  
PROSITE View protein in PROSITE  
PS00646  RIBOSOMAL_S13_1  
PS50159  RIBOSOMAL_S13_2  
Amino Acid Sequences MVVHILGKAFKGKEVVRIGLSSKFYGIGLPTAETVCSKLGFYPWMRMHQLSEPQILSIASELSHMTIEDDARAVVRANIAVKKRIGSYEGLRHALHLPVRGQKTKNNAKTARKLNKLDRKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.34
3 0.31
4 0.32
5 0.32
6 0.31
7 0.33
8 0.25
9 0.21
10 0.19
11 0.17
12 0.16
13 0.15
14 0.12
15 0.1
16 0.1
17 0.1
18 0.1
19 0.1
20 0.1
21 0.1
22 0.1
23 0.09
24 0.09
25 0.08
26 0.09
27 0.13
28 0.14
29 0.21
30 0.22
31 0.26
32 0.28
33 0.28
34 0.29
35 0.29
36 0.34
37 0.27
38 0.27
39 0.23
40 0.21
41 0.21
42 0.18
43 0.14
44 0.08
45 0.06
46 0.04
47 0.05
48 0.05
49 0.04
50 0.05
51 0.04
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.06
64 0.09
65 0.13
66 0.15
67 0.18
68 0.19
69 0.2
70 0.21
71 0.21
72 0.21
73 0.2
74 0.24
75 0.29
76 0.33
77 0.35
78 0.33
79 0.34
80 0.33
81 0.33
82 0.29
83 0.24
84 0.23
85 0.28
86 0.34
87 0.38
88 0.39
89 0.4
90 0.49
91 0.56
92 0.61
93 0.63
94 0.66
95 0.7
96 0.78
97 0.83
98 0.83
99 0.82
100 0.82
101 0.83