Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2S4Q0F3

Protein Details
Accession A0A2S4Q0F3    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
173-194QIEIEIRRLRKRRTKAEVKVKKBasic
NLS Segment(s)
PositionSequence
179-194RRLRKRRTKAEVKVKK
Subcellular Location(s) nucl 15.5, cyto_nucl 14, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040357  Vma22/CCDC115  
Gene Ontology GO:0070072  P:vacuolar proton-transporting V-type ATPase complex assembly  
Amino Acid Sequences MKEDNLSDDIENLLAQYLDLVDEYDLLRRRLYMLQISARQNLARANFSAARGIKYGEELYDSRIQALRLCRVTVDAEKGKRKFTVLTKDTSRGKSDPTVASEVKERALDDLSQEKKISGDGQTTEDTARTIKNDPIRMFGILTPASLRLVQTDSIKMVNIIPRLVELDAELAQIEIEIRRLRKRRTKAEVKVKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.05
5 0.05
6 0.05
7 0.06
8 0.05
9 0.06
10 0.07
11 0.12
12 0.16
13 0.16
14 0.17
15 0.16
16 0.19
17 0.22
18 0.26
19 0.25
20 0.28
21 0.33
22 0.4
23 0.43
24 0.42
25 0.41
26 0.37
27 0.32
28 0.31
29 0.27
30 0.22
31 0.2
32 0.23
33 0.23
34 0.24
35 0.28
36 0.25
37 0.24
38 0.23
39 0.23
40 0.18
41 0.18
42 0.18
43 0.12
44 0.14
45 0.12
46 0.16
47 0.2
48 0.2
49 0.19
50 0.2
51 0.2
52 0.21
53 0.24
54 0.25
55 0.21
56 0.21
57 0.2
58 0.2
59 0.22
60 0.21
61 0.24
62 0.23
63 0.28
64 0.35
65 0.36
66 0.37
67 0.35
68 0.34
69 0.33
70 0.33
71 0.38
72 0.33
73 0.37
74 0.38
75 0.43
76 0.46
77 0.44
78 0.41
79 0.31
80 0.31
81 0.28
82 0.29
83 0.25
84 0.23
85 0.25
86 0.22
87 0.22
88 0.22
89 0.21
90 0.18
91 0.16
92 0.14
93 0.11
94 0.12
95 0.11
96 0.1
97 0.17
98 0.18
99 0.19
100 0.19
101 0.18
102 0.17
103 0.17
104 0.17
105 0.11
106 0.12
107 0.12
108 0.15
109 0.16
110 0.16
111 0.16
112 0.14
113 0.13
114 0.11
115 0.11
116 0.1
117 0.12
118 0.16
119 0.21
120 0.28
121 0.28
122 0.31
123 0.32
124 0.3
125 0.29
126 0.25
127 0.24
128 0.17
129 0.17
130 0.14
131 0.13
132 0.13
133 0.12
134 0.12
135 0.09
136 0.11
137 0.13
138 0.14
139 0.15
140 0.15
141 0.16
142 0.16
143 0.15
144 0.16
145 0.18
146 0.17
147 0.16
148 0.15
149 0.15
150 0.17
151 0.16
152 0.14
153 0.09
154 0.1
155 0.1
156 0.1
157 0.09
158 0.07
159 0.07
160 0.07
161 0.07
162 0.05
163 0.09
164 0.13
165 0.17
166 0.27
167 0.35
168 0.45
169 0.55
170 0.64
171 0.71
172 0.78
173 0.85
174 0.87