Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4PSL9

Protein Details
Accession A0A2S4PSL9    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
48-68GPPPSRFRLPKPKRWNESKESHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, cyto_mito 12.5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR017896  4Fe4S_Fe-S-bd  
IPR017900  4Fe4S_Fe_S_CS  
IPR010226  NADH_quinone_OxRdtase_chainI  
Gene Ontology GO:0016020  C:membrane  
GO:0051539  F:4 iron, 4 sulfur cluster binding  
GO:0016651  F:oxidoreductase activity, acting on NAD(P)H  
Pfam View protein in Pfam  
PF12838  Fer4_7  
PROSITE View protein in PROSITE  
PS00198  4FE4S_FER_1  
PS51379  4FE4S_FER_2  
Amino Acid Sequences MAPLKASKFLTNSSQRQLTYLGKPIRTICPFAFALRSQSVRSYATPSGPPPSRFRLPKPKRWNESKESVLDKAGTYFLMTEMLRGMYVVLEQFFRPPYTIYYPFEKGPISPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEERQDGSRRTTRYDIDMTKCIYCGFCQESCPVDAIVESPNAEYATATREELLYNKEKLLSNGDKWEPEIAAAARADAPYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.48
3 0.47
4 0.48
5 0.45
6 0.4
7 0.44
8 0.43
9 0.39
10 0.42
11 0.44
12 0.47
13 0.45
14 0.45
15 0.36
16 0.35
17 0.35
18 0.34
19 0.34
20 0.27
21 0.29
22 0.28
23 0.3
24 0.25
25 0.27
26 0.28
27 0.27
28 0.27
29 0.27
30 0.25
31 0.26
32 0.28
33 0.27
34 0.32
35 0.35
36 0.37
37 0.36
38 0.41
39 0.46
40 0.48
41 0.55
42 0.59
43 0.62
44 0.69
45 0.75
46 0.79
47 0.79
48 0.84
49 0.84
50 0.79
51 0.78
52 0.72
53 0.67
54 0.6
55 0.52
56 0.44
57 0.37
58 0.3
59 0.23
60 0.18
61 0.13
62 0.09
63 0.08
64 0.07
65 0.09
66 0.09
67 0.08
68 0.08
69 0.08
70 0.08
71 0.07
72 0.07
73 0.04
74 0.05
75 0.05
76 0.05
77 0.05
78 0.06
79 0.07
80 0.08
81 0.08
82 0.09
83 0.09
84 0.12
85 0.17
86 0.21
87 0.22
88 0.25
89 0.27
90 0.27
91 0.27
92 0.24
93 0.19
94 0.23
95 0.28
96 0.29
97 0.29
98 0.32
99 0.32
100 0.33
101 0.38
102 0.35
103 0.36
104 0.37
105 0.42
106 0.39
107 0.39
108 0.39
109 0.35
110 0.38
111 0.33
112 0.3
113 0.24
114 0.25
115 0.26
116 0.27
117 0.26
118 0.19
119 0.16
120 0.17
121 0.16
122 0.16
123 0.17
124 0.16
125 0.17
126 0.18
127 0.16
128 0.15
129 0.14
130 0.13
131 0.1
132 0.09
133 0.08
134 0.07
135 0.08
136 0.07
137 0.08
138 0.08
139 0.12
140 0.12
141 0.18
142 0.23
143 0.24
144 0.29
145 0.32
146 0.32
147 0.34
148 0.39
149 0.39
150 0.38
151 0.4
152 0.38
153 0.34
154 0.33
155 0.29
156 0.23
157 0.18
158 0.18
159 0.19
160 0.17
161 0.19
162 0.21
163 0.22
164 0.22
165 0.23
166 0.18
167 0.14
168 0.13
169 0.12
170 0.11
171 0.1
172 0.1
173 0.09
174 0.1
175 0.1
176 0.1
177 0.09
178 0.08
179 0.11
180 0.11
181 0.12
182 0.11
183 0.11
184 0.12
185 0.15
186 0.2
187 0.21
188 0.22
189 0.22
190 0.26
191 0.27
192 0.28
193 0.35
194 0.35
195 0.34
196 0.4
197 0.42
198 0.39
199 0.4
200 0.4
201 0.32
202 0.26
203 0.26
204 0.19
205 0.19
206 0.18
207 0.18
208 0.17