Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4PYA1

Protein Details
Accession A0A2S4PYA1    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
267-292VWDRDVVARRRGKKPSKKKNGKDKATBasic
NLS Segment(s)
PositionSequence
275-291RRRGKKPSKKKNGKDKA
Subcellular Location(s) mito 11, nucl 9, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR034751  Yippee  
IPR004910  Yippee/Mis18/Cereblon  
IPR039058  Yippee_fam  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF03226  Yippee-Mis18  
PROSITE View protein in PROSITE  
PS51792  YIPPEE  
Amino Acid Sequences MALETLPPFVTFLLPIPRLSRRKRPLSAACSSSTSSFSCDSALSASSTSNTTPNSSTTGSSLTVSTFDNPSSCYSSSSSLQIRNSLSDPKSTPVRLTSRYPSTLRCLKCSTDFAYTSQILSKGFTGRLGRAFLVAPPPQPPFVPSFPPKPRPKAELVNTRIEQPMSRELITGWHVVADVSCVVCATVVGWKYIHTREESQQYKIGKVILERERVCVGGTWEDEETLDGQEAVNRVGTVEEWAYQESESAIQFDSGDEEECESLFSGVWDRDVVARRRGKKPSKKKNGKDKAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.26
4 0.35
5 0.43
6 0.5
7 0.58
8 0.59
9 0.68
10 0.72
11 0.78
12 0.79
13 0.77
14 0.77
15 0.7
16 0.63
17 0.57
18 0.52
19 0.44
20 0.36
21 0.29
22 0.25
23 0.22
24 0.19
25 0.17
26 0.16
27 0.15
28 0.14
29 0.14
30 0.12
31 0.11
32 0.11
33 0.11
34 0.12
35 0.12
36 0.14
37 0.14
38 0.16
39 0.16
40 0.17
41 0.2
42 0.2
43 0.2
44 0.18
45 0.2
46 0.18
47 0.17
48 0.16
49 0.13
50 0.13
51 0.13
52 0.13
53 0.12
54 0.12
55 0.12
56 0.13
57 0.15
58 0.18
59 0.18
60 0.18
61 0.19
62 0.22
63 0.22
64 0.26
65 0.27
66 0.27
67 0.28
68 0.3
69 0.29
70 0.28
71 0.28
72 0.3
73 0.27
74 0.27
75 0.27
76 0.27
77 0.3
78 0.29
79 0.28
80 0.27
81 0.32
82 0.31
83 0.35
84 0.38
85 0.38
86 0.42
87 0.42
88 0.39
89 0.4
90 0.44
91 0.41
92 0.39
93 0.37
94 0.35
95 0.36
96 0.37
97 0.34
98 0.31
99 0.31
100 0.27
101 0.29
102 0.27
103 0.24
104 0.22
105 0.19
106 0.14
107 0.14
108 0.14
109 0.11
110 0.11
111 0.13
112 0.13
113 0.14
114 0.16
115 0.17
116 0.15
117 0.15
118 0.15
119 0.12
120 0.15
121 0.15
122 0.13
123 0.14
124 0.16
125 0.15
126 0.15
127 0.16
128 0.15
129 0.17
130 0.21
131 0.22
132 0.29
133 0.34
134 0.44
135 0.47
136 0.49
137 0.51
138 0.49
139 0.52
140 0.51
141 0.53
142 0.54
143 0.53
144 0.55
145 0.51
146 0.49
147 0.45
148 0.37
149 0.29
150 0.22
151 0.23
152 0.18
153 0.18
154 0.16
155 0.15
156 0.17
157 0.19
158 0.16
159 0.11
160 0.09
161 0.09
162 0.08
163 0.08
164 0.07
165 0.05
166 0.04
167 0.04
168 0.04
169 0.04
170 0.04
171 0.04
172 0.03
173 0.06
174 0.07
175 0.08
176 0.08
177 0.1
178 0.14
179 0.16
180 0.18
181 0.18
182 0.21
183 0.25
184 0.34
185 0.36
186 0.35
187 0.38
188 0.37
189 0.35
190 0.32
191 0.29
192 0.21
193 0.2
194 0.26
195 0.27
196 0.34
197 0.33
198 0.35
199 0.34
200 0.33
201 0.32
202 0.24
203 0.21
204 0.17
205 0.17
206 0.16
207 0.16
208 0.15
209 0.15
210 0.14
211 0.13
212 0.09
213 0.09
214 0.07
215 0.06
216 0.08
217 0.09
218 0.09
219 0.09
220 0.08
221 0.08
222 0.08
223 0.08
224 0.09
225 0.09
226 0.1
227 0.11
228 0.12
229 0.12
230 0.12
231 0.12
232 0.1
233 0.11
234 0.1
235 0.1
236 0.09
237 0.09
238 0.09
239 0.09
240 0.11
241 0.1
242 0.11
243 0.1
244 0.11
245 0.11
246 0.11
247 0.12
248 0.1
249 0.09
250 0.08
251 0.08
252 0.11
253 0.11
254 0.12
255 0.11
256 0.12
257 0.17
258 0.25
259 0.29
260 0.34
261 0.42
262 0.49
263 0.57
264 0.67
265 0.73
266 0.76
267 0.83
268 0.85
269 0.89
270 0.92
271 0.94
272 0.95