Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4PTB5

Protein Details
Accession A0A2S4PTB5    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
476-504VNRGDLKRGNDRNKKSNFNRNSRNFRGSHHydrophilic
NLS Segment(s)
PositionSequence
487-508RNKKSNFNRNSRNFRGSHGRKR
Subcellular Location(s) nucl 12, mito 9, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007708  DBR1_C  
IPR029052  Metallo-depent_PP-like  
Gene Ontology GO:0016788  F:hydrolase activity, acting on ester bonds  
GO:0046872  F:metal ion binding  
GO:0006397  P:mRNA processing  
Pfam View protein in Pfam  
PF05011  DBR1  
Amino Acid Sequences MACPVKYRRIGDFHSYYSGARKAPYLTIFVGGNHEASNHLWELFYGGWVAPNIYYMGAANILRVGGVRIAGMSGIWKGYNFRKSHYERLPYNQDDIRSIYHVREIETRKLLQVKTQVDVGISHDWPKSIELYGNTKKLFKNKPDFQKESRDGTFGNVAAKLVMDHLRPPYWFSAHMHCKYAAIKAYDEISSKTSNDFTSSLSSTIQSIKQDVLRNKDEIDLDLEQTGNNETSIGVPESKKEISLKLDHVGNDYEKLVHTNCDTISKVLKSQYSKDNEAIKSSIPISVRAQLPAAFFRPNPIPISLPPEITNKTVRFLSLDKCLPGRKFLQLLTIDPQTTLASSNSLKDGKLKFEYDPEWLAITRAFDSAMIFGDRNAQTPPDLGEAHYLPLIQKELEWVNEHVVKAGKLQIPENFEITATPYQPGTPEIVKEGPLEYNNPQTQKFCDLIGITNKLFATEEERADRLQKGPALVDDVNRGDLKRGNDRNKKSNFNRNSRNFRGSHGRKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.49
3 0.43
4 0.42
5 0.41
6 0.33
7 0.29
8 0.29
9 0.26
10 0.31
11 0.32
12 0.3
13 0.27
14 0.28
15 0.27
16 0.25
17 0.27
18 0.22
19 0.21
20 0.16
21 0.16
22 0.15
23 0.15
24 0.18
25 0.14
26 0.14
27 0.13
28 0.12
29 0.15
30 0.13
31 0.13
32 0.1
33 0.09
34 0.11
35 0.11
36 0.12
37 0.09
38 0.1
39 0.1
40 0.09
41 0.09
42 0.08
43 0.08
44 0.1
45 0.1
46 0.09
47 0.09
48 0.09
49 0.09
50 0.09
51 0.09
52 0.07
53 0.07
54 0.07
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.06
61 0.07
62 0.07
63 0.08
64 0.12
65 0.19
66 0.28
67 0.28
68 0.31
69 0.4
70 0.46
71 0.56
72 0.6
73 0.62
74 0.58
75 0.66
76 0.71
77 0.64
78 0.63
79 0.56
80 0.48
81 0.42
82 0.4
83 0.33
84 0.27
85 0.26
86 0.22
87 0.24
88 0.24
89 0.23
90 0.29
91 0.32
92 0.35
93 0.39
94 0.39
95 0.38
96 0.43
97 0.41
98 0.38
99 0.42
100 0.37
101 0.34
102 0.35
103 0.31
104 0.25
105 0.26
106 0.24
107 0.2
108 0.18
109 0.2
110 0.18
111 0.18
112 0.18
113 0.19
114 0.17
115 0.13
116 0.16
117 0.16
118 0.24
119 0.3
120 0.34
121 0.34
122 0.37
123 0.38
124 0.45
125 0.5
126 0.5
127 0.55
128 0.59
129 0.69
130 0.75
131 0.78
132 0.74
133 0.76
134 0.71
135 0.68
136 0.6
137 0.51
138 0.41
139 0.37
140 0.36
141 0.26
142 0.22
143 0.16
144 0.14
145 0.13
146 0.12
147 0.1
148 0.09
149 0.1
150 0.09
151 0.11
152 0.14
153 0.16
154 0.16
155 0.18
156 0.19
157 0.18
158 0.2
159 0.2
160 0.27
161 0.34
162 0.36
163 0.36
164 0.34
165 0.34
166 0.33
167 0.34
168 0.29
169 0.22
170 0.2
171 0.19
172 0.2
173 0.2
174 0.19
175 0.17
176 0.15
177 0.15
178 0.15
179 0.15
180 0.15
181 0.14
182 0.15
183 0.14
184 0.13
185 0.16
186 0.16
187 0.15
188 0.14
189 0.14
190 0.13
191 0.15
192 0.15
193 0.12
194 0.13
195 0.13
196 0.18
197 0.23
198 0.26
199 0.3
200 0.31
201 0.31
202 0.31
203 0.32
204 0.27
205 0.22
206 0.22
207 0.17
208 0.15
209 0.14
210 0.13
211 0.1
212 0.1
213 0.11
214 0.07
215 0.06
216 0.05
217 0.05
218 0.05
219 0.07
220 0.07
221 0.08
222 0.08
223 0.09
224 0.12
225 0.12
226 0.13
227 0.12
228 0.14
229 0.16
230 0.19
231 0.2
232 0.19
233 0.21
234 0.2
235 0.21
236 0.2
237 0.17
238 0.15
239 0.13
240 0.11
241 0.09
242 0.1
243 0.09
244 0.09
245 0.09
246 0.09
247 0.09
248 0.12
249 0.12
250 0.12
251 0.15
252 0.14
253 0.16
254 0.17
255 0.21
256 0.2
257 0.23
258 0.3
259 0.32
260 0.34
261 0.36
262 0.4
263 0.37
264 0.37
265 0.34
266 0.26
267 0.23
268 0.21
269 0.19
270 0.13
271 0.15
272 0.14
273 0.18
274 0.19
275 0.18
276 0.18
277 0.17
278 0.18
279 0.17
280 0.17
281 0.14
282 0.13
283 0.16
284 0.17
285 0.17
286 0.18
287 0.17
288 0.17
289 0.17
290 0.24
291 0.22
292 0.21
293 0.21
294 0.23
295 0.23
296 0.24
297 0.28
298 0.22
299 0.23
300 0.22
301 0.21
302 0.2
303 0.2
304 0.21
305 0.22
306 0.23
307 0.22
308 0.24
309 0.28
310 0.26
311 0.28
312 0.27
313 0.25
314 0.26
315 0.25
316 0.29
317 0.26
318 0.27
319 0.27
320 0.27
321 0.23
322 0.21
323 0.21
324 0.15
325 0.13
326 0.13
327 0.09
328 0.1
329 0.1
330 0.12
331 0.14
332 0.15
333 0.15
334 0.2
335 0.22
336 0.24
337 0.27
338 0.28
339 0.26
340 0.3
341 0.31
342 0.28
343 0.28
344 0.23
345 0.21
346 0.19
347 0.18
348 0.15
349 0.14
350 0.12
351 0.1
352 0.1
353 0.09
354 0.09
355 0.09
356 0.09
357 0.09
358 0.08
359 0.08
360 0.16
361 0.16
362 0.17
363 0.17
364 0.16
365 0.15
366 0.16
367 0.18
368 0.14
369 0.14
370 0.13
371 0.16
372 0.16
373 0.16
374 0.16
375 0.15
376 0.11
377 0.13
378 0.14
379 0.1
380 0.09
381 0.12
382 0.13
383 0.15
384 0.18
385 0.17
386 0.21
387 0.24
388 0.24
389 0.23
390 0.23
391 0.21
392 0.2
393 0.26
394 0.24
395 0.23
396 0.26
397 0.27
398 0.32
399 0.33
400 0.32
401 0.26
402 0.23
403 0.21
404 0.23
405 0.22
406 0.17
407 0.16
408 0.15
409 0.15
410 0.16
411 0.17
412 0.17
413 0.15
414 0.15
415 0.19
416 0.2
417 0.21
418 0.21
419 0.21
420 0.2
421 0.2
422 0.23
423 0.21
424 0.29
425 0.32
426 0.34
427 0.35
428 0.34
429 0.36
430 0.37
431 0.35
432 0.27
433 0.26
434 0.24
435 0.28
436 0.32
437 0.33
438 0.28
439 0.31
440 0.3
441 0.27
442 0.27
443 0.22
444 0.22
445 0.22
446 0.26
447 0.26
448 0.28
449 0.28
450 0.31
451 0.33
452 0.27
453 0.29
454 0.27
455 0.26
456 0.26
457 0.26
458 0.3
459 0.28
460 0.28
461 0.28
462 0.27
463 0.28
464 0.27
465 0.26
466 0.24
467 0.27
468 0.3
469 0.36
470 0.44
471 0.52
472 0.61
473 0.69
474 0.76
475 0.8
476 0.85
477 0.83
478 0.84
479 0.84
480 0.84
481 0.87
482 0.87
483 0.89
484 0.87
485 0.86
486 0.76
487 0.72
488 0.73