Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4Q0Q5

Protein Details
Accession A0A2S4Q0Q5    Localization Confidence High Confidence Score 23.5
NoLS Segment(s)
PositionSequenceProtein Nature
100-120LRSAVSKKKAEKNKDNPRDPVHydrophilic
161-186NPKILQDKKRTARKKPGKKRGYVDEEBasic
199-221IEKPAKKKRVSAKDKKIARKEDEBasic
NLS Segment(s)
PositionSequence
168-180KKRTARKKPGKKR
199-218IEKPAKKKRVSAKDKKIARK
278-291EKEKPFKAKRGRPR
Subcellular Location(s) nucl 23.5, cyto_nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001510  Znf_PARP  
IPR036957  Znf_PARP_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00645  zf-PARP  
Amino Acid Sequences RLRLGTWVDIPDRGGSWRWRHWGCVTGKILQNIRNALDHNDSGEYSWDALDGYQGADEKSSLEHFPDLQEKVRRVVTQGYIDPEDFKGDPEMNKLGCTGLRSAVSKKKAEKNKDNPRDPVELKKQLDELAAERQAKLAKGASISKIDTQLKILQNLLDAENPKILQDKKRTARKKPGKKRGYVDEESDAEDSKEPKEDIEKPAKKKRVSAKDKKIARKEDESIPESKTFDKNDIKSEEDHVSCEDSEERNNNLIKKESSTQRIKEEDYGNGFQDDVKEKEKPFKAKRGRPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.27
3 0.33
4 0.39
5 0.46
6 0.46
7 0.5
8 0.51
9 0.55
10 0.51
11 0.53
12 0.49
13 0.47
14 0.49
15 0.51
16 0.52
17 0.48
18 0.49
19 0.43
20 0.42
21 0.37
22 0.35
23 0.33
24 0.33
25 0.28
26 0.25
27 0.24
28 0.22
29 0.2
30 0.2
31 0.17
32 0.13
33 0.12
34 0.1
35 0.09
36 0.08
37 0.09
38 0.07
39 0.06
40 0.07
41 0.07
42 0.07
43 0.07
44 0.08
45 0.07
46 0.09
47 0.1
48 0.1
49 0.11
50 0.12
51 0.12
52 0.15
53 0.2
54 0.2
55 0.25
56 0.3
57 0.3
58 0.32
59 0.35
60 0.33
61 0.3
62 0.33
63 0.31
64 0.3
65 0.31
66 0.31
67 0.3
68 0.29
69 0.29
70 0.23
71 0.22
72 0.17
73 0.16
74 0.14
75 0.15
76 0.15
77 0.17
78 0.2
79 0.17
80 0.17
81 0.17
82 0.15
83 0.14
84 0.15
85 0.13
86 0.11
87 0.13
88 0.15
89 0.2
90 0.26
91 0.3
92 0.33
93 0.39
94 0.45
95 0.52
96 0.6
97 0.65
98 0.69
99 0.76
100 0.82
101 0.8
102 0.76
103 0.72
104 0.69
105 0.61
106 0.58
107 0.55
108 0.53
109 0.49
110 0.45
111 0.41
112 0.35
113 0.34
114 0.26
115 0.19
116 0.16
117 0.19
118 0.18
119 0.17
120 0.18
121 0.18
122 0.17
123 0.16
124 0.13
125 0.09
126 0.11
127 0.13
128 0.13
129 0.14
130 0.15
131 0.15
132 0.19
133 0.19
134 0.17
135 0.18
136 0.22
137 0.22
138 0.22
139 0.21
140 0.16
141 0.16
142 0.17
143 0.16
144 0.11
145 0.11
146 0.11
147 0.11
148 0.11
149 0.1
150 0.14
151 0.15
152 0.2
153 0.27
154 0.35
155 0.43
156 0.53
157 0.6
158 0.65
159 0.74
160 0.78
161 0.82
162 0.84
163 0.86
164 0.84
165 0.84
166 0.82
167 0.81
168 0.78
169 0.7
170 0.62
171 0.55
172 0.48
173 0.42
174 0.37
175 0.27
176 0.19
177 0.18
178 0.15
179 0.12
180 0.13
181 0.11
182 0.12
183 0.17
184 0.2
185 0.26
186 0.36
187 0.42
188 0.48
189 0.58
190 0.65
191 0.61
192 0.65
193 0.68
194 0.68
195 0.72
196 0.75
197 0.77
198 0.78
199 0.85
200 0.87
201 0.86
202 0.83
203 0.78
204 0.74
205 0.67
206 0.66
207 0.64
208 0.57
209 0.51
210 0.45
211 0.41
212 0.36
213 0.35
214 0.32
215 0.27
216 0.31
217 0.37
218 0.36
219 0.41
220 0.43
221 0.42
222 0.4
223 0.42
224 0.4
225 0.33
226 0.32
227 0.26
228 0.25
229 0.22
230 0.23
231 0.21
232 0.17
233 0.22
234 0.24
235 0.25
236 0.28
237 0.32
238 0.33
239 0.34
240 0.37
241 0.34
242 0.36
243 0.41
244 0.43
245 0.49
246 0.54
247 0.55
248 0.57
249 0.6
250 0.58
251 0.57
252 0.53
253 0.5
254 0.48
255 0.46
256 0.4
257 0.36
258 0.33
259 0.27
260 0.28
261 0.27
262 0.24
263 0.25
264 0.29
265 0.31
266 0.41
267 0.48
268 0.54
269 0.57
270 0.64
271 0.71