Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J7S7R9

Protein Details
Accession J7S7R9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
101-129PTDPHFTRTSYRKKNKNKRNLVKLHIYIHHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 16, E.R. 7, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR031430  Osw5  
Gene Ontology GO:0016020  C:membrane  
GO:0030435  P:sporulation resulting in formation of a cellular spore  
Pfam View protein in Pfam  
PF17062  Osw5  
Amino Acid Sequences MALLGIIVYAAAFFALTIASSLLIIPLLVMSFIFATLVIVFGFISNATFKMCQAIIFRVEGILHGIYFHMITIRRQEEIQMKRFTSVGQSTRLYCTTITVPTDPHFTRTSYRKKNKNKRNLVKLHIYIHLQTIYGLIIFGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.04
5 0.04
6 0.04
7 0.04
8 0.05
9 0.05
10 0.05
11 0.04
12 0.04
13 0.04
14 0.03
15 0.03
16 0.03
17 0.04
18 0.04
19 0.04
20 0.04
21 0.04
22 0.04
23 0.04
24 0.05
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.04
31 0.05
32 0.05
33 0.05
34 0.06
35 0.07
36 0.07
37 0.09
38 0.09
39 0.1
40 0.12
41 0.14
42 0.14
43 0.14
44 0.14
45 0.11
46 0.11
47 0.1
48 0.09
49 0.07
50 0.06
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.06
58 0.06
59 0.12
60 0.13
61 0.13
62 0.13
63 0.17
64 0.24
65 0.29
66 0.35
67 0.34
68 0.33
69 0.33
70 0.33
71 0.3
72 0.26
73 0.26
74 0.21
75 0.22
76 0.23
77 0.24
78 0.26
79 0.27
80 0.23
81 0.18
82 0.18
83 0.15
84 0.17
85 0.18
86 0.16
87 0.17
88 0.17
89 0.24
90 0.22
91 0.23
92 0.22
93 0.22
94 0.28
95 0.35
96 0.44
97 0.49
98 0.59
99 0.66
100 0.75
101 0.85
102 0.89
103 0.91
104 0.92
105 0.92
106 0.93
107 0.92
108 0.87
109 0.86
110 0.81
111 0.73
112 0.66
113 0.58
114 0.48
115 0.43
116 0.37
117 0.27
118 0.21
119 0.18
120 0.14
121 0.11