Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4PWR3

Protein Details
Accession A0A2S4PWR3    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-32VNIPKTRRTFCKGKDCKKHTQHKVTQYKAGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 8.5, cyto_nucl 8, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRRTFCKGKDCKKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTVCKTKAQLALKRCKHFELGYVEFHFYQFFLDLEYGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.83
3 0.82
4 0.86
5 0.86
6 0.88
7 0.87
8 0.87
9 0.85
10 0.85
11 0.88
12 0.82
13 0.81
14 0.75
15 0.7
16 0.62
17 0.56
18 0.46
19 0.37
20 0.35
21 0.35
22 0.33
23 0.3
24 0.35
25 0.38
26 0.43
27 0.48
28 0.53
29 0.49
30 0.56
31 0.63
32 0.6
33 0.62
34 0.6
35 0.59
36 0.58
37 0.6
38 0.51
39 0.46
40 0.42
41 0.34
42 0.36
43 0.37
44 0.35
45 0.3
46 0.36
47 0.4
48 0.49
49 0.57
50 0.6
51 0.6
52 0.63
53 0.7
54 0.71
55 0.69
56 0.66
57 0.61
58 0.58
59 0.56
60 0.51
61 0.46
62 0.43
63 0.37
64 0.32
65 0.29
66 0.29
67 0.33
68 0.39
69 0.41
70 0.44
71 0.54
72 0.61
73 0.66
74 0.64
75 0.58
76 0.54
77 0.49
78 0.47
79 0.45
80 0.4
81 0.39
82 0.39
83 0.39
84 0.35
85 0.34
86 0.28
87 0.19
88 0.17
89 0.12
90 0.1
91 0.1