Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4PKX1

Protein Details
Accession A0A2S4PKX1   
Localization Confidence Low
Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
254-278EFKACDKKIIKSKKKHDESDYHCFKBasic
NLS Segment(s)
Subcellular Location(s) mito 12.5, mito_nucl 9.499, cyto 8.5, cyto_nucl 8.333, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016191  Ribonuclease/ribotoxin  
Gene Ontology GO:0003723  F:RNA binding  
GO:0004540  F:RNA nuclease activity  
Amino Acid Sequences MTTFRVVFTRDSDEVVGVVSKITTNDYTKCIRRDNSYIGSSHLESEDFNGFLCGNRFFADEIIQQSLALAQTSVQGSSIYPYPYFGLLYPADEGFLMWPIMRGKKLYKSGKTAHIGPFYLILNKERLFVDVVVSGYGKNFLRCIRSRQAPKAPASDPHSKLFVQPPKPGYLCGKTFFDNKVLEDAAKIAKKHASKVVKSKFPQSYSGHPYYKPCLIWPLLKDGNIYRRGMKAPYRLILTPNYEVMSVAILVKNEFKACDKKIIKSKKKHDESDYHCFKQNLSYQQLVDAAEKACVQMNSAVTNHFPAGYEGPKFNSEGPYFTYPAVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.18
4 0.11
5 0.1
6 0.08
7 0.08
8 0.08
9 0.12
10 0.14
11 0.17
12 0.2
13 0.24
14 0.32
15 0.37
16 0.42
17 0.47
18 0.47
19 0.5
20 0.55
21 0.58
22 0.58
23 0.54
24 0.5
25 0.45
26 0.45
27 0.38
28 0.33
29 0.26
30 0.2
31 0.16
32 0.19
33 0.18
34 0.14
35 0.13
36 0.12
37 0.11
38 0.12
39 0.14
40 0.12
41 0.11
42 0.12
43 0.13
44 0.13
45 0.14
46 0.16
47 0.16
48 0.18
49 0.19
50 0.18
51 0.17
52 0.16
53 0.17
54 0.13
55 0.11
56 0.08
57 0.05
58 0.08
59 0.09
60 0.09
61 0.08
62 0.08
63 0.08
64 0.1
65 0.13
66 0.12
67 0.11
68 0.12
69 0.13
70 0.13
71 0.14
72 0.12
73 0.14
74 0.12
75 0.13
76 0.14
77 0.12
78 0.12
79 0.11
80 0.11
81 0.07
82 0.08
83 0.07
84 0.05
85 0.08
86 0.1
87 0.13
88 0.14
89 0.16
90 0.18
91 0.26
92 0.36
93 0.42
94 0.44
95 0.49
96 0.53
97 0.59
98 0.58
99 0.56
100 0.52
101 0.47
102 0.42
103 0.35
104 0.33
105 0.25
106 0.24
107 0.2
108 0.16
109 0.16
110 0.16
111 0.17
112 0.15
113 0.16
114 0.15
115 0.14
116 0.14
117 0.12
118 0.12
119 0.1
120 0.1
121 0.09
122 0.07
123 0.1
124 0.09
125 0.08
126 0.1
127 0.11
128 0.17
129 0.19
130 0.26
131 0.3
132 0.38
133 0.44
134 0.5
135 0.56
136 0.55
137 0.56
138 0.54
139 0.49
140 0.46
141 0.45
142 0.47
143 0.41
144 0.37
145 0.36
146 0.31
147 0.32
148 0.35
149 0.36
150 0.31
151 0.33
152 0.33
153 0.35
154 0.35
155 0.35
156 0.31
157 0.28
158 0.26
159 0.25
160 0.25
161 0.23
162 0.25
163 0.25
164 0.25
165 0.22
166 0.2
167 0.19
168 0.18
169 0.16
170 0.13
171 0.14
172 0.13
173 0.15
174 0.14
175 0.13
176 0.18
177 0.19
178 0.22
179 0.28
180 0.32
181 0.34
182 0.44
183 0.5
184 0.54
185 0.54
186 0.6
187 0.58
188 0.53
189 0.56
190 0.49
191 0.49
192 0.49
193 0.54
194 0.48
195 0.43
196 0.43
197 0.4
198 0.41
199 0.33
200 0.26
201 0.25
202 0.25
203 0.28
204 0.26
205 0.3
206 0.28
207 0.28
208 0.29
209 0.28
210 0.33
211 0.33
212 0.33
213 0.27
214 0.28
215 0.3
216 0.33
217 0.35
218 0.34
219 0.35
220 0.37
221 0.38
222 0.36
223 0.37
224 0.37
225 0.36
226 0.3
227 0.27
228 0.24
229 0.2
230 0.19
231 0.17
232 0.13
233 0.09
234 0.09
235 0.08
236 0.08
237 0.08
238 0.1
239 0.11
240 0.11
241 0.12
242 0.16
243 0.22
244 0.24
245 0.34
246 0.35
247 0.42
248 0.51
249 0.61
250 0.67
251 0.71
252 0.79
253 0.8
254 0.86
255 0.85
256 0.84
257 0.83
258 0.81
259 0.81
260 0.79
261 0.71
262 0.67
263 0.6
264 0.52
265 0.5
266 0.49
267 0.46
268 0.43
269 0.43
270 0.38
271 0.4
272 0.41
273 0.35
274 0.29
275 0.23
276 0.18
277 0.16
278 0.16
279 0.15
280 0.16
281 0.15
282 0.15
283 0.16
284 0.18
285 0.2
286 0.2
287 0.21
288 0.19
289 0.21
290 0.2
291 0.16
292 0.15
293 0.15
294 0.19
295 0.21
296 0.24
297 0.23
298 0.26
299 0.27
300 0.28
301 0.28
302 0.32
303 0.29
304 0.28
305 0.32
306 0.34
307 0.34