Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2S4PX35

Protein Details
Accession A0A2S4PX35    Localization Confidence High Confidence Score 18.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MKRNPRKLKWTKAFRKNAGKEMIHydrophilic
NLS Segment(s)
PositionSequence
6-10RKLKW
62-62R
68-71KKRM
Subcellular Location(s) nucl 17, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
Amino Acid Sequences MKRNPRKLKWTKAFRKNAGKEMIVDTSLTFAARRNIPVRYNRILIAKTLEAMKRINEIRQKRERVFYKKRMAGNRLRERELNRKLVETQSHLLPQMSGSMKKRLAEEALNDPQLDVIDQTKKRLALKVVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.91
3 0.86
4 0.83
5 0.78
6 0.68
7 0.6
8 0.53
9 0.46
10 0.35
11 0.29
12 0.21
13 0.16
14 0.15
15 0.13
16 0.09
17 0.09
18 0.13
19 0.15
20 0.19
21 0.2
22 0.24
23 0.3
24 0.37
25 0.42
26 0.41
27 0.41
28 0.39
29 0.4
30 0.36
31 0.32
32 0.28
33 0.21
34 0.18
35 0.2
36 0.18
37 0.16
38 0.16
39 0.16
40 0.17
41 0.18
42 0.22
43 0.27
44 0.31
45 0.38
46 0.46
47 0.51
48 0.49
49 0.56
50 0.59
51 0.61
52 0.65
53 0.66
54 0.66
55 0.66
56 0.69
57 0.68
58 0.66
59 0.65
60 0.66
61 0.67
62 0.62
63 0.59
64 0.57
65 0.56
66 0.6
67 0.58
68 0.54
69 0.45
70 0.43
71 0.43
72 0.43
73 0.41
74 0.35
75 0.31
76 0.26
77 0.26
78 0.25
79 0.23
80 0.19
81 0.16
82 0.17
83 0.17
84 0.2
85 0.21
86 0.27
87 0.29
88 0.31
89 0.32
90 0.3
91 0.31
92 0.29
93 0.3
94 0.32
95 0.35
96 0.35
97 0.33
98 0.3
99 0.27
100 0.24
101 0.2
102 0.13
103 0.12
104 0.19
105 0.21
106 0.25
107 0.28
108 0.32
109 0.35
110 0.39