Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2S4PJR2

Protein Details
Accession A0A2S4PJR2    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
113-133QEQKRLWKLANKNTKRKGEFRHydrophilic
NLS Segment(s)
PositionSequence
150-154RKKKR
Subcellular Location(s) nucl 14.5, mito 12, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR000266  Ribosomal_S17/S11  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00366  Ribosomal_S17  
Amino Acid Sequences MTALSLTRKVAEQAGKSIPAVVISAGLMQKTVKARTGMQEWNSRIKKNFNRHKDVLVHDPNDSLRTGDIISISSGMRVSKTVRHTVENIIAPFGTPIEDRPPIPTYEERRILQEQKRLWKLANKNTKRKGEFRPEDFVLTEKQKEDLLSRKKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.31
4 0.31
5 0.25
6 0.2
7 0.18
8 0.12
9 0.09
10 0.07
11 0.1
12 0.09
13 0.09
14 0.08
15 0.08
16 0.12
17 0.15
18 0.17
19 0.18
20 0.2
21 0.22
22 0.27
23 0.32
24 0.35
25 0.35
26 0.42
27 0.41
28 0.49
29 0.5
30 0.48
31 0.45
32 0.49
33 0.53
34 0.56
35 0.64
36 0.62
37 0.68
38 0.67
39 0.7
40 0.66
41 0.61
42 0.59
43 0.55
44 0.47
45 0.38
46 0.37
47 0.32
48 0.28
49 0.24
50 0.15
51 0.09
52 0.08
53 0.08
54 0.07
55 0.07
56 0.06
57 0.06
58 0.07
59 0.07
60 0.06
61 0.06
62 0.06
63 0.06
64 0.06
65 0.08
66 0.12
67 0.15
68 0.21
69 0.22
70 0.24
71 0.26
72 0.27
73 0.31
74 0.28
75 0.25
76 0.2
77 0.18
78 0.16
79 0.14
80 0.11
81 0.08
82 0.05
83 0.06
84 0.1
85 0.12
86 0.12
87 0.16
88 0.18
89 0.18
90 0.22
91 0.27
92 0.29
93 0.36
94 0.41
95 0.38
96 0.41
97 0.46
98 0.5
99 0.49
100 0.5
101 0.48
102 0.52
103 0.57
104 0.53
105 0.51
106 0.51
107 0.55
108 0.57
109 0.63
110 0.63
111 0.68
112 0.76
113 0.83
114 0.8
115 0.79
116 0.78
117 0.78
118 0.78
119 0.73
120 0.72
121 0.64
122 0.61
123 0.54
124 0.46
125 0.41
126 0.36
127 0.34
128 0.27
129 0.26
130 0.25
131 0.26
132 0.3
133 0.34
134 0.4