Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4PIT0

Protein Details
Accession A0A2S4PIT0   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
16-43LATGRITKKRIQRYKKKTNPINERRLNNHydrophilic
NLS Segment(s)
PositionSequence
24-31KRIQRYKK
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, cyto 6.5, mito 4
Family & Domain DBs
Amino Acid Sequences QLLLDIDFEEASQTALATGRITKKRIQRYKKKTNPINERRLNNFNEAMITSTSEELRNKDFYFDTCASTHMCPNAERFVSPQKCTGFVNPSSGEFMEILGKGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.07
4 0.07
5 0.11
6 0.19
7 0.24
8 0.27
9 0.32
10 0.4
11 0.51
12 0.61
13 0.67
14 0.7
15 0.76
16 0.85
17 0.89
18 0.91
19 0.88
20 0.88
21 0.88
22 0.87
23 0.87
24 0.83
25 0.78
26 0.73
27 0.71
28 0.63
29 0.55
30 0.46
31 0.35
32 0.28
33 0.24
34 0.19
35 0.13
36 0.12
37 0.09
38 0.08
39 0.09
40 0.1
41 0.11
42 0.11
43 0.13
44 0.15
45 0.15
46 0.16
47 0.16
48 0.15
49 0.22
50 0.21
51 0.21
52 0.19
53 0.2
54 0.2
55 0.21
56 0.22
57 0.17
58 0.17
59 0.16
60 0.18
61 0.22
62 0.2
63 0.2
64 0.22
65 0.3
66 0.34
67 0.34
68 0.38
69 0.34
70 0.35
71 0.37
72 0.39
73 0.35
74 0.31
75 0.36
76 0.31
77 0.31
78 0.32
79 0.3
80 0.27
81 0.2
82 0.19
83 0.16