Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4PXI2

Protein Details
Accession A0A2S4PXI2   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
101-132FGPHKNKKPYVASKGRKFEKARGRRRSRGFKVBasic
NLS Segment(s)
PositionSequence
97-132KHFGFGPHKNKKPYVASKGRKFEKARGRRRSRGFKV
Subcellular Location(s) mito 22, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036227  L18e/L15P_sf  
IPR000039  Ribosomal_L18e  
IPR021131  Ribosomal_L18e/L15P  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF17135  Ribosomal_L18  
Amino Acid Sequences MSRINRPPVSISRIVANISEESKNKMIVVIGTVTDDARLLQVPKLSVAALRFTSTARARILAAGGETLTLDQLALRSPTGSNTLLIRGPKNSREAVKHFGFGPHKNKKPYVASKGRKFEKARGRRRSRGFKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.31
3 0.27
4 0.22
5 0.21
6 0.23
7 0.2
8 0.24
9 0.24
10 0.24
11 0.22
12 0.2
13 0.18
14 0.14
15 0.15
16 0.11
17 0.1
18 0.1
19 0.1
20 0.09
21 0.09
22 0.08
23 0.06
24 0.06
25 0.07
26 0.07
27 0.09
28 0.1
29 0.11
30 0.11
31 0.11
32 0.11
33 0.11
34 0.11
35 0.12
36 0.11
37 0.11
38 0.11
39 0.11
40 0.16
41 0.16
42 0.18
43 0.16
44 0.16
45 0.15
46 0.15
47 0.15
48 0.1
49 0.09
50 0.06
51 0.05
52 0.05
53 0.04
54 0.04
55 0.03
56 0.03
57 0.03
58 0.02
59 0.03
60 0.04
61 0.04
62 0.04
63 0.05
64 0.05
65 0.07
66 0.1
67 0.11
68 0.11
69 0.11
70 0.13
71 0.15
72 0.16
73 0.17
74 0.18
75 0.21
76 0.23
77 0.26
78 0.28
79 0.3
80 0.34
81 0.38
82 0.41
83 0.39
84 0.37
85 0.34
86 0.37
87 0.39
88 0.4
89 0.45
90 0.48
91 0.54
92 0.58
93 0.6
94 0.6
95 0.65
96 0.67
97 0.67
98 0.68
99 0.71
100 0.75
101 0.83
102 0.81
103 0.8
104 0.75
105 0.74
106 0.74
107 0.75
108 0.76
109 0.77
110 0.82
111 0.83
112 0.89