Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2S4PN48

Protein Details
Accession A0A2S4PN48    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
59-85LERLKKRRLELREKRLREKPAQKNEEEBasic
NLS Segment(s)
PositionSequence
61-79RLKKRRLELREKRLREKPA
Subcellular Location(s) nucl 14.5, cyto_nucl 12, cyto 8.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018625  Pet100  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
Pfam View protein in Pfam  
PF09803  Pet100  
Amino Acid Sequences MGGFNLEVFKFSMYIMFPIAIMYYYGTNLDNRFSVPGFWPKSEESYRIPFDREEIKAELERLKKRRLELREKRLREKPAQKNEEES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.1
5 0.09
6 0.1
7 0.07
8 0.07
9 0.07
10 0.06
11 0.06
12 0.07
13 0.08
14 0.09
15 0.09
16 0.1
17 0.1
18 0.1
19 0.11
20 0.1
21 0.11
22 0.12
23 0.19
24 0.2
25 0.2
26 0.22
27 0.21
28 0.26
29 0.26
30 0.26
31 0.22
32 0.25
33 0.27
34 0.26
35 0.27
36 0.22
37 0.23
38 0.25
39 0.23
40 0.22
41 0.2
42 0.22
43 0.22
44 0.23
45 0.27
46 0.28
47 0.35
48 0.36
49 0.42
50 0.43
51 0.48
52 0.55
53 0.58
54 0.63
55 0.66
56 0.72
57 0.76
58 0.8
59 0.83
60 0.82
61 0.81
62 0.8
63 0.8
64 0.8
65 0.8
66 0.81