Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S4PID5

Protein Details
Accession A0A2S4PID5   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-36IPTAMSICRYRRRQRVRHTAQNRRYNSEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 10, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MALFEQWRIPTAMSICRYRRRQRVRHTAQNRRYNSETLHSPVDINPSNKINGSISKFTEGTFDDARVDISEREQIAEEYARAFYEATSCVQKLGLGRDTSPLERALAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.39
3 0.47
4 0.56
5 0.62
6 0.7
7 0.73
8 0.79
9 0.82
10 0.87
11 0.87
12 0.89
13 0.9
14 0.9
15 0.89
16 0.89
17 0.82
18 0.77
19 0.71
20 0.62
21 0.53
22 0.47
23 0.4
24 0.33
25 0.31
26 0.25
27 0.22
28 0.21
29 0.24
30 0.23
31 0.21
32 0.2
33 0.2
34 0.2
35 0.2
36 0.2
37 0.15
38 0.16
39 0.19
40 0.19
41 0.18
42 0.2
43 0.2
44 0.19
45 0.19
46 0.16
47 0.16
48 0.15
49 0.14
50 0.12
51 0.12
52 0.13
53 0.11
54 0.12
55 0.08
56 0.09
57 0.12
58 0.11
59 0.12
60 0.12
61 0.12
62 0.12
63 0.13
64 0.12
65 0.09
66 0.1
67 0.09
68 0.09
69 0.09
70 0.07
71 0.08
72 0.1
73 0.11
74 0.14
75 0.14
76 0.14
77 0.14
78 0.16
79 0.16
80 0.21
81 0.25
82 0.23
83 0.23
84 0.28
85 0.32
86 0.32
87 0.31
88 0.27