Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2S4PIE9

Protein Details
Accession A0A2S4PIE9    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MPSGVTRRRGKARRSSGPRFPSEHydrophilic
NLS Segment(s)
PositionSequence
7-15RRRGKARRS
Subcellular Location(s) nucl 15.5, cyto_nucl 12.333, mito_nucl 11.832, mito 6.5
Family & Domain DBs
Amino Acid Sequences MPSGVTRRRGKARRSSGPRFPSEWASSKEAFQNAVWSFEYKNISKRPEINTNTGLSETVPRSPKYINPSIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.82
3 0.81
4 0.8
5 0.76
6 0.68
7 0.61
8 0.56
9 0.51
10 0.48
11 0.42
12 0.39
13 0.36
14 0.34
15 0.34
16 0.29
17 0.25
18 0.2
19 0.22
20 0.17
21 0.19
22 0.18
23 0.16
24 0.15
25 0.18
26 0.21
27 0.16
28 0.22
29 0.25
30 0.28
31 0.3
32 0.35
33 0.37
34 0.44
35 0.47
36 0.47
37 0.45
38 0.44
39 0.41
40 0.36
41 0.31
42 0.22
43 0.23
44 0.19
45 0.22
46 0.25
47 0.24
48 0.27
49 0.29
50 0.34
51 0.37