Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J7RA97

Protein Details
Accession J7RA97   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
194-239PAHYIEYLKKHRTNRKRLQDDTIARAQVRWRGGRPPIKRKRIGRKRBasic
NLS Segment(s)
PositionSequence
219-239AQVRWRGGRPPIKRKRIGRKR
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 7, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MGLLNPLKPLACNTFGTTFSKSHEVDKIENYLRAAQGILEDVRRRVSQEQDRVSLKKNQALRPSNFKVGQKVLIKKDVYMKPKRGQKFHFLWYGPYAIVEVINPNSYRVETGTDTLRHCVFNARDLKPFSERENDYGRIPPLTREAQLANLNQIVGFGKLSMRPEGTMVETVWRDAEAWDTIQMPLELVESHLPAHYIEYLKKHRTNRKRLQDDTIARAQVRWRGGRPPIKRKRIGRKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.34
4 0.33
5 0.29
6 0.29
7 0.33
8 0.3
9 0.31
10 0.34
11 0.34
12 0.34
13 0.37
14 0.4
15 0.37
16 0.38
17 0.36
18 0.34
19 0.3
20 0.27
21 0.23
22 0.16
23 0.13
24 0.14
25 0.13
26 0.14
27 0.16
28 0.17
29 0.2
30 0.2
31 0.23
32 0.24
33 0.32
34 0.37
35 0.45
36 0.48
37 0.51
38 0.55
39 0.54
40 0.54
41 0.53
42 0.47
43 0.44
44 0.46
45 0.47
46 0.52
47 0.58
48 0.58
49 0.6
50 0.61
51 0.63
52 0.6
53 0.56
54 0.51
55 0.45
56 0.48
57 0.45
58 0.47
59 0.43
60 0.46
61 0.44
62 0.41
63 0.47
64 0.47
65 0.49
66 0.5
67 0.53
68 0.53
69 0.62
70 0.66
71 0.64
72 0.62
73 0.62
74 0.59
75 0.57
76 0.57
77 0.49
78 0.45
79 0.39
80 0.36
81 0.27
82 0.21
83 0.16
84 0.1
85 0.09
86 0.07
87 0.07
88 0.06
89 0.08
90 0.08
91 0.08
92 0.09
93 0.09
94 0.09
95 0.09
96 0.11
97 0.1
98 0.11
99 0.14
100 0.16
101 0.16
102 0.18
103 0.18
104 0.15
105 0.15
106 0.19
107 0.16
108 0.2
109 0.27
110 0.27
111 0.3
112 0.31
113 0.33
114 0.31
115 0.33
116 0.28
117 0.29
118 0.28
119 0.27
120 0.31
121 0.3
122 0.28
123 0.29
124 0.27
125 0.22
126 0.21
127 0.19
128 0.18
129 0.19
130 0.18
131 0.17
132 0.17
133 0.19
134 0.23
135 0.22
136 0.19
137 0.17
138 0.16
139 0.14
140 0.14
141 0.11
142 0.07
143 0.07
144 0.05
145 0.06
146 0.08
147 0.1
148 0.11
149 0.11
150 0.11
151 0.12
152 0.13
153 0.14
154 0.14
155 0.12
156 0.14
157 0.14
158 0.14
159 0.13
160 0.12
161 0.1
162 0.09
163 0.11
164 0.09
165 0.09
166 0.1
167 0.11
168 0.11
169 0.12
170 0.11
171 0.09
172 0.08
173 0.08
174 0.07
175 0.08
176 0.09
177 0.08
178 0.09
179 0.09
180 0.09
181 0.08
182 0.1
183 0.12
184 0.13
185 0.16
186 0.23
187 0.31
188 0.39
189 0.45
190 0.53
191 0.61
192 0.69
193 0.78
194 0.8
195 0.84
196 0.86
197 0.84
198 0.82
199 0.82
200 0.77
201 0.73
202 0.69
203 0.61
204 0.51
205 0.49
206 0.44
207 0.4
208 0.41
209 0.39
210 0.36
211 0.41
212 0.5
213 0.58
214 0.64
215 0.7
216 0.74
217 0.78
218 0.85
219 0.87