Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J7R867

Protein Details
Accession J7R867   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MRRSRTTRRTKNLRDARHDRVLRBasic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR013743  NBP1_fun  
Pfam View protein in Pfam  
PF08537  NBP1  
Amino Acid Sequences MRRSRTTRRTKNLRDARHDRVLRRSSLWDRIKGYIFGDLEDPSARVAVLEGQMERLRRQLVSTRNKLRYAREKNTLYQKLLDDADVDTTYVKSKRRIQNLQPPAAQQEKDTVKTLPPSPKRPVAPLVTSSPIRTKQASKPGRSNLVENPPLMSDYHKFKSLPTTESMQRSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.86
3 0.83
4 0.82
5 0.79
6 0.72
7 0.72
8 0.68
9 0.61
10 0.57
11 0.57
12 0.52
13 0.57
14 0.58
15 0.53
16 0.52
17 0.52
18 0.52
19 0.45
20 0.4
21 0.35
22 0.29
23 0.24
24 0.22
25 0.18
26 0.17
27 0.16
28 0.15
29 0.09
30 0.09
31 0.08
32 0.06
33 0.06
34 0.07
35 0.08
36 0.09
37 0.08
38 0.11
39 0.13
40 0.15
41 0.15
42 0.15
43 0.15
44 0.14
45 0.16
46 0.2
47 0.28
48 0.37
49 0.45
50 0.52
51 0.55
52 0.6
53 0.61
54 0.61
55 0.63
56 0.62
57 0.59
58 0.59
59 0.57
60 0.57
61 0.64
62 0.61
63 0.51
64 0.44
65 0.39
66 0.33
67 0.3
68 0.25
69 0.15
70 0.12
71 0.12
72 0.09
73 0.09
74 0.06
75 0.06
76 0.09
77 0.11
78 0.13
79 0.17
80 0.26
81 0.33
82 0.42
83 0.49
84 0.55
85 0.63
86 0.69
87 0.68
88 0.61
89 0.55
90 0.5
91 0.46
92 0.38
93 0.28
94 0.27
95 0.25
96 0.26
97 0.27
98 0.23
99 0.22
100 0.25
101 0.3
102 0.33
103 0.37
104 0.41
105 0.45
106 0.51
107 0.51
108 0.51
109 0.51
110 0.47
111 0.43
112 0.4
113 0.39
114 0.36
115 0.35
116 0.33
117 0.33
118 0.31
119 0.31
120 0.3
121 0.32
122 0.35
123 0.45
124 0.52
125 0.53
126 0.59
127 0.63
128 0.68
129 0.65
130 0.61
131 0.58
132 0.59
133 0.55
134 0.47
135 0.42
136 0.33
137 0.32
138 0.29
139 0.25
140 0.2
141 0.24
142 0.28
143 0.3
144 0.3
145 0.3
146 0.4
147 0.4
148 0.39
149 0.36
150 0.39
151 0.41