Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J7S3M7

Protein Details
Accession J7S3M7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
10-41LANQKFNKKVEQNRKYGKKKVSKKDKDGKVSIHydrophilic
NLS Segment(s)
PositionSequence
17-36KKVEQNRKYGKKKVSKKDKD
Subcellular Location(s) plas 6, E.R. 5, mito 4, golg 4, cyto 3.5, cyto_nucl 3, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR010580  ER_stress-assoc  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF06624  RAMP4  
Amino Acid Sequences MAVQTPKQRLANQKFNKKVEQNRKYGKKKVSKKDKDGKVSISKYWVGALLFLLIGGGVLELLKFII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.75
3 0.78
4 0.75
5 0.77
6 0.77
7 0.75
8 0.74
9 0.76
10 0.82
11 0.81
12 0.81
13 0.79
14 0.78
15 0.8
16 0.81
17 0.82
18 0.81
19 0.83
20 0.85
21 0.84
22 0.81
23 0.74
24 0.69
25 0.67
26 0.6
27 0.52
28 0.45
29 0.38
30 0.31
31 0.28
32 0.24
33 0.15
34 0.13
35 0.12
36 0.09
37 0.08
38 0.07
39 0.06
40 0.04
41 0.04
42 0.03
43 0.03
44 0.02
45 0.02
46 0.02