Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J7S4B1

Protein Details
Accession J7S4B1    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
20-39AKLFEKQRRVLERRIKELKKBasic
NLS Segment(s)
Subcellular Location(s) cyto 11, cyto_pero 10.333, cyto_nucl 9.333, pero 8.5, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007577  GlycoTrfase_DXD_sugar-bd_CS  
IPR029044  Nucleotide-diphossugar_trans  
IPR039367  Och1-like  
Gene Ontology GO:0000009  F:alpha-1,6-mannosyltransferase activity  
GO:1901135  P:carbohydrate derivative metabolic process  
Pfam View protein in Pfam  
PF04488  Gly_transf_sug  
Amino Acid Sequences MMAKFELLAKEMRLKQDEQAKLFEKQRRVLERRIKELKKLPDEATLREKLAYAFEYDSSRRFPAFIWQTWPSQGMQDSKGVLVEDVASNRANWDEKNPGFVHEIINDNIAGALVRHYYASIPDVLEAYNSLPNKILKIDFFKYLILLARGGLYADMDTVPLQPIPNWVPAQMDPGKIGLVVGIEHDAKDATWRNEYVRRLQFGTWIIQAKPGHPVIREVVAHITETTLDRKMRGELNLNFRNDLNIMSWTGSGVWTDALFTYFNDYLRSGVTKKVTWKEFHNLAVPKLLSDVLVFPEFSLKAPNKISSDDPNKSMYFATHEGAKFWKTVPKVEDPSAPQKLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.41
3 0.49
4 0.53
5 0.47
6 0.5
7 0.47
8 0.5
9 0.56
10 0.57
11 0.55
12 0.55
13 0.61
14 0.65
15 0.67
16 0.7
17 0.73
18 0.73
19 0.77
20 0.8
21 0.75
22 0.73
23 0.76
24 0.76
25 0.73
26 0.71
27 0.63
28 0.61
29 0.61
30 0.57
31 0.56
32 0.49
33 0.41
34 0.36
35 0.35
36 0.26
37 0.26
38 0.22
39 0.17
40 0.16
41 0.16
42 0.2
43 0.21
44 0.23
45 0.23
46 0.24
47 0.22
48 0.21
49 0.19
50 0.25
51 0.31
52 0.31
53 0.34
54 0.35
55 0.36
56 0.37
57 0.38
58 0.28
59 0.24
60 0.26
61 0.23
62 0.22
63 0.22
64 0.21
65 0.2
66 0.2
67 0.18
68 0.14
69 0.1
70 0.1
71 0.09
72 0.09
73 0.11
74 0.1
75 0.1
76 0.1
77 0.12
78 0.12
79 0.11
80 0.15
81 0.22
82 0.22
83 0.28
84 0.28
85 0.28
86 0.29
87 0.29
88 0.27
89 0.21
90 0.23
91 0.18
92 0.18
93 0.16
94 0.13
95 0.12
96 0.1
97 0.07
98 0.05
99 0.05
100 0.05
101 0.05
102 0.05
103 0.05
104 0.06
105 0.07
106 0.08
107 0.08
108 0.08
109 0.08
110 0.08
111 0.08
112 0.08
113 0.07
114 0.08
115 0.1
116 0.1
117 0.1
118 0.12
119 0.12
120 0.13
121 0.15
122 0.14
123 0.13
124 0.19
125 0.2
126 0.2
127 0.21
128 0.2
129 0.18
130 0.18
131 0.17
132 0.12
133 0.1
134 0.08
135 0.07
136 0.07
137 0.07
138 0.06
139 0.05
140 0.04
141 0.04
142 0.04
143 0.04
144 0.04
145 0.05
146 0.05
147 0.05
148 0.06
149 0.05
150 0.08
151 0.1
152 0.13
153 0.13
154 0.13
155 0.14
156 0.14
157 0.19
158 0.18
159 0.17
160 0.14
161 0.14
162 0.13
163 0.12
164 0.11
165 0.06
166 0.04
167 0.04
168 0.04
169 0.05
170 0.05
171 0.05
172 0.05
173 0.05
174 0.05
175 0.08
176 0.12
177 0.12
178 0.14
179 0.15
180 0.18
181 0.24
182 0.26
183 0.32
184 0.33
185 0.33
186 0.33
187 0.33
188 0.33
189 0.29
190 0.3
191 0.24
192 0.22
193 0.2
194 0.24
195 0.24
196 0.21
197 0.23
198 0.23
199 0.22
200 0.2
201 0.22
202 0.18
203 0.21
204 0.21
205 0.17
206 0.17
207 0.16
208 0.16
209 0.13
210 0.12
211 0.09
212 0.1
213 0.11
214 0.13
215 0.13
216 0.13
217 0.15
218 0.17
219 0.2
220 0.22
221 0.28
222 0.29
223 0.39
224 0.44
225 0.44
226 0.42
227 0.39
228 0.37
229 0.29
230 0.25
231 0.17
232 0.12
233 0.12
234 0.12
235 0.11
236 0.1
237 0.1
238 0.09
239 0.08
240 0.07
241 0.06
242 0.05
243 0.06
244 0.06
245 0.07
246 0.07
247 0.07
248 0.12
249 0.13
250 0.14
251 0.15
252 0.15
253 0.15
254 0.16
255 0.19
256 0.15
257 0.19
258 0.22
259 0.24
260 0.31
261 0.39
262 0.42
263 0.42
264 0.47
265 0.5
266 0.51
267 0.51
268 0.51
269 0.45
270 0.41
271 0.44
272 0.39
273 0.3
274 0.27
275 0.24
276 0.17
277 0.14
278 0.15
279 0.12
280 0.13
281 0.13
282 0.11
283 0.15
284 0.15
285 0.15
286 0.21
287 0.2
288 0.25
289 0.28
290 0.33
291 0.32
292 0.34
293 0.38
294 0.4
295 0.48
296 0.47
297 0.46
298 0.45
299 0.43
300 0.42
301 0.38
302 0.29
303 0.27
304 0.25
305 0.24
306 0.26
307 0.26
308 0.27
309 0.3
310 0.3
311 0.25
312 0.24
313 0.29
314 0.25
315 0.32
316 0.35
317 0.42
318 0.46
319 0.49
320 0.54
321 0.53
322 0.61