Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J7R988

Protein Details
Accession J7R988    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
34-60VDESDPKKKDREPKKRLNRNSVSGKQVHydrophilic
NLS Segment(s)
PositionSequence
40-50KKKDREPKKRL
Subcellular Location(s) nucl 10, mito 9, cyto_nucl 7, E.R. 3, cyto 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000850  Adenylat/UMP-CMP_kin  
IPR033690  Adenylat_kinase_CS  
IPR027417  P-loop_NTPase  
IPR006266  UMP_CMP_kinase  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0005524  F:ATP binding  
GO:0004127  F:cytidylate kinase activity  
GO:0033862  F:UMP kinase activity  
GO:0006207  P:'de novo' pyrimidine nucleobase biosynthetic process  
GO:0016310  P:phosphorylation  
GO:0006221  P:pyrimidine nucleotide biosynthetic process  
Pfam View protein in Pfam  
PF00406  ADK  
PROSITE View protein in PROSITE  
PS00113  ADENYLATE_KINASE  
CDD cd01428  ADK  
Amino Acid Sequences MTAPLRGIYTARVLLQQSSRKTTFHTEKFSKQTVDESDPKKKDREPKKRLNRNSVSGKQVAVVGLLALGTTILSLLYSKSKPVEFLEEDPTPAEMTETAGRPIFTPEEVSVIFVLGGPGAGKGTQCDNLVRDYHFVHLSAGDLLRAEQNRPDSEYGKLIKHYITEGLIVPQEITVKLLENAIRDNFKEGRTKFLVDGFPRKMDQAITFEDVIVPSKFVLFFDCPEEVMEKRLLERGKTSGRADDNIESIKKRFKTFVETSMPVIEYFEEQNKVIKIKCDKSVEEVYNDVQQQLKGKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.31
3 0.37
4 0.38
5 0.43
6 0.44
7 0.41
8 0.44
9 0.5
10 0.53
11 0.53
12 0.58
13 0.56
14 0.63
15 0.69
16 0.7
17 0.63
18 0.54
19 0.52
20 0.48
21 0.49
22 0.49
23 0.49
24 0.54
25 0.57
26 0.59
27 0.58
28 0.58
29 0.61
30 0.64
31 0.69
32 0.69
33 0.75
34 0.83
35 0.89
36 0.92
37 0.93
38 0.89
39 0.87
40 0.87
41 0.82
42 0.76
43 0.67
44 0.57
45 0.47
46 0.4
47 0.31
48 0.21
49 0.15
50 0.08
51 0.06
52 0.06
53 0.05
54 0.03
55 0.03
56 0.02
57 0.02
58 0.02
59 0.02
60 0.02
61 0.03
62 0.04
63 0.09
64 0.1
65 0.12
66 0.14
67 0.15
68 0.17
69 0.19
70 0.25
71 0.23
72 0.26
73 0.3
74 0.28
75 0.28
76 0.26
77 0.25
78 0.18
79 0.15
80 0.12
81 0.06
82 0.08
83 0.11
84 0.11
85 0.12
86 0.12
87 0.13
88 0.13
89 0.15
90 0.13
91 0.11
92 0.12
93 0.11
94 0.13
95 0.12
96 0.13
97 0.1
98 0.09
99 0.09
100 0.07
101 0.07
102 0.04
103 0.04
104 0.03
105 0.03
106 0.03
107 0.04
108 0.04
109 0.05
110 0.07
111 0.09
112 0.1
113 0.11
114 0.12
115 0.14
116 0.15
117 0.15
118 0.15
119 0.14
120 0.15
121 0.14
122 0.14
123 0.11
124 0.1
125 0.1
126 0.09
127 0.08
128 0.06
129 0.05
130 0.06
131 0.08
132 0.08
133 0.08
134 0.1
135 0.12
136 0.13
137 0.15
138 0.17
139 0.15
140 0.16
141 0.2
142 0.21
143 0.19
144 0.19
145 0.18
146 0.17
147 0.16
148 0.15
149 0.12
150 0.1
151 0.1
152 0.09
153 0.09
154 0.09
155 0.09
156 0.08
157 0.07
158 0.07
159 0.06
160 0.07
161 0.06
162 0.06
163 0.07
164 0.09
165 0.09
166 0.09
167 0.11
168 0.12
169 0.13
170 0.13
171 0.17
172 0.18
173 0.19
174 0.26
175 0.24
176 0.3
177 0.31
178 0.32
179 0.29
180 0.32
181 0.34
182 0.3
183 0.37
184 0.33
185 0.33
186 0.31
187 0.31
188 0.27
189 0.23
190 0.22
191 0.18
192 0.19
193 0.19
194 0.19
195 0.18
196 0.18
197 0.16
198 0.17
199 0.13
200 0.1
201 0.08
202 0.08
203 0.08
204 0.08
205 0.12
206 0.11
207 0.12
208 0.15
209 0.16
210 0.15
211 0.16
212 0.18
213 0.15
214 0.16
215 0.17
216 0.14
217 0.15
218 0.2
219 0.2
220 0.2
221 0.22
222 0.26
223 0.3
224 0.35
225 0.36
226 0.37
227 0.39
228 0.39
229 0.4
230 0.36
231 0.32
232 0.32
233 0.32
234 0.28
235 0.27
236 0.33
237 0.33
238 0.34
239 0.35
240 0.34
241 0.41
242 0.43
243 0.49
244 0.5
245 0.48
246 0.47
247 0.46
248 0.43
249 0.34
250 0.3
251 0.22
252 0.16
253 0.17
254 0.19
255 0.18
256 0.18
257 0.22
258 0.24
259 0.27
260 0.27
261 0.32
262 0.37
263 0.4
264 0.48
265 0.5
266 0.5
267 0.53
268 0.6
269 0.56
270 0.5
271 0.47
272 0.42
273 0.41
274 0.4
275 0.34
276 0.28
277 0.26