Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S5BE10

Protein Details
Accession A0A2S5BE10    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
236-257VTPERLQRRRHLRSLARRKTEAHydrophilic
NLS Segment(s)
PositionSequence
145-149ERKRK
187-196LGPKRATKIR
213-262RREVVPKKEGAKPYTKAPKIQRLVTPERLQRRRHLRSLARRKTEAQKAQK
270-293AKRLAERKQAASAVKAKKAAARAA
Subcellular Location(s) cyto 12, cyto_nucl 11.333, nucl 8.5, mito_nucl 8.166, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001377  Ribosomal_S6e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01092  Ribosomal_S6e  
Amino Acid Sequences MKLVLANPATGQQKTIEIDDERKTRIFYEKRMAQEVAADQLGDEFKGYVVRITGGNDVRVFSRSSYLVSPADGNASSADGIFSSSHRPFPLLSCPALAHDSHRYATRNDAHAAGFPLKQGVLVPHRVRLLLAKGHSCYRPRRDGERKRKSVRGCIVGPDVRALHLVVVKQGEQDIPGLTDEVLPKRLGPKRATKIRRFFNLDKSDDVRKFVIRREVVPKKEGAKPYTKAPKIQRLVTPERLQRRRHLRSLARRKTEAQKAQKAEYEQIVAKRLAERKQAASAVKAKKAAARAAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.24
4 0.24
5 0.29
6 0.35
7 0.38
8 0.37
9 0.36
10 0.36
11 0.34
12 0.41
13 0.41
14 0.41
15 0.47
16 0.51
17 0.54
18 0.58
19 0.56
20 0.46
21 0.44
22 0.38
23 0.32
24 0.25
25 0.2
26 0.15
27 0.16
28 0.16
29 0.11
30 0.1
31 0.07
32 0.07
33 0.09
34 0.09
35 0.08
36 0.09
37 0.1
38 0.1
39 0.12
40 0.18
41 0.18
42 0.21
43 0.2
44 0.2
45 0.2
46 0.21
47 0.2
48 0.14
49 0.16
50 0.14
51 0.16
52 0.16
53 0.19
54 0.18
55 0.17
56 0.18
57 0.15
58 0.16
59 0.14
60 0.13
61 0.1
62 0.1
63 0.09
64 0.08
65 0.08
66 0.05
67 0.07
68 0.06
69 0.07
70 0.12
71 0.13
72 0.16
73 0.16
74 0.17
75 0.16
76 0.19
77 0.26
78 0.23
79 0.23
80 0.22
81 0.22
82 0.22
83 0.23
84 0.21
85 0.16
86 0.18
87 0.19
88 0.19
89 0.22
90 0.22
91 0.22
92 0.28
93 0.3
94 0.28
95 0.27
96 0.28
97 0.25
98 0.24
99 0.26
100 0.21
101 0.16
102 0.13
103 0.12
104 0.11
105 0.1
106 0.09
107 0.1
108 0.11
109 0.18
110 0.19
111 0.22
112 0.22
113 0.22
114 0.22
115 0.2
116 0.2
117 0.17
118 0.18
119 0.17
120 0.18
121 0.21
122 0.24
123 0.27
124 0.31
125 0.33
126 0.39
127 0.41
128 0.49
129 0.57
130 0.65
131 0.72
132 0.76
133 0.79
134 0.76
135 0.79
136 0.73
137 0.71
138 0.66
139 0.6
140 0.5
141 0.44
142 0.43
143 0.38
144 0.35
145 0.27
146 0.21
147 0.16
148 0.15
149 0.12
150 0.09
151 0.09
152 0.08
153 0.08
154 0.09
155 0.09
156 0.09
157 0.09
158 0.08
159 0.07
160 0.08
161 0.07
162 0.06
163 0.06
164 0.07
165 0.06
166 0.08
167 0.09
168 0.1
169 0.12
170 0.11
171 0.11
172 0.19
173 0.24
174 0.28
175 0.31
176 0.39
177 0.47
178 0.58
179 0.66
180 0.68
181 0.72
182 0.73
183 0.77
184 0.75
185 0.7
186 0.7
187 0.69
188 0.62
189 0.57
190 0.54
191 0.54
192 0.46
193 0.45
194 0.37
195 0.33
196 0.33
197 0.33
198 0.39
199 0.32
200 0.36
201 0.43
202 0.5
203 0.49
204 0.5
205 0.49
206 0.44
207 0.5
208 0.51
209 0.46
210 0.45
211 0.44
212 0.51
213 0.57
214 0.56
215 0.56
216 0.59
217 0.64
218 0.62
219 0.65
220 0.6
221 0.58
222 0.63
223 0.64
224 0.63
225 0.6
226 0.66
227 0.68
228 0.67
229 0.68
230 0.71
231 0.71
232 0.71
233 0.74
234 0.74
235 0.77
236 0.85
237 0.86
238 0.82
239 0.78
240 0.77
241 0.76
242 0.76
243 0.75
244 0.74
245 0.73
246 0.7
247 0.71
248 0.69
249 0.63
250 0.57
251 0.5
252 0.44
253 0.38
254 0.37
255 0.36
256 0.32
257 0.3
258 0.33
259 0.36
260 0.38
261 0.42
262 0.44
263 0.44
264 0.5
265 0.53
266 0.49
267 0.49
268 0.52
269 0.51
270 0.51
271 0.5
272 0.46
273 0.45
274 0.48