Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S5AZT0

Protein Details
Accession A0A2S5AZT0    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
21-40IPKAVKPSNRKGKQSQRAAFHydrophilic
59-89MELIRNSKDKKARKLTKKRLGTLRRAKRKVDBasic
NLS Segment(s)
PositionSequence
64-87NSKDKKARKLTKKRLGTLRRAKRK
Subcellular Location(s) mito 19, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MATTRTNLPWGLNRGHPTTVIPKAVKPSNRKGKQSQRAAFVKSIVREVVGFAPYERRVMELIRNSKDKKARKLTKKRLGTLRRAKRKVDELTGVIAEQRRHAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.38
3 0.36
4 0.32
5 0.34
6 0.34
7 0.35
8 0.31
9 0.3
10 0.35
11 0.41
12 0.45
13 0.45
14 0.51
15 0.56
16 0.62
17 0.67
18 0.7
19 0.75
20 0.78
21 0.81
22 0.75
23 0.72
24 0.69
25 0.65
26 0.57
27 0.49
28 0.42
29 0.32
30 0.29
31 0.2
32 0.17
33 0.14
34 0.14
35 0.12
36 0.09
37 0.09
38 0.07
39 0.11
40 0.11
41 0.12
42 0.11
43 0.1
44 0.1
45 0.12
46 0.17
47 0.2
48 0.26
49 0.29
50 0.35
51 0.36
52 0.41
53 0.49
54 0.51
55 0.54
56 0.59
57 0.65
58 0.71
59 0.81
60 0.86
61 0.88
62 0.89
63 0.87
64 0.86
65 0.84
66 0.84
67 0.84
68 0.83
69 0.84
70 0.81
71 0.77
72 0.74
73 0.75
74 0.71
75 0.67
76 0.61
77 0.52
78 0.51
79 0.47
80 0.4
81 0.34
82 0.31
83 0.24