Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S5B409

Protein Details
Accession A0A2S5B409    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
168-195HGQNSFTDKKRREKCLVKNKDIRKASRAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto_nucl 11, cyto 8, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000702  Ribosomal_L6  
IPR020040  Ribosomal_L6_a/b-dom  
IPR036789  Ribosomal_L6_a/b-dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00347  Ribosomal_L6  
Amino Acid Sequences MKQIYKEEEFEIPEGVTVAIKARIVTVTGPRGTLQKNLQHTNMSMRITAPSDKAIKPVHKVKLVVWHGARKHVACLRTVRSIIENMVTGVRYGFSYKMRLVYAHFPINVIIADNKESVEIRNFLGEKRVRNVKMLEGVTISESKSQKDEIIIEGNDVDMVSQSAADIHGQNSFTDKKRREKCLVKNKDIRKASRAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.14
3 0.1
4 0.08
5 0.09
6 0.09
7 0.1
8 0.1
9 0.1
10 0.11
11 0.12
12 0.14
13 0.18
14 0.22
15 0.22
16 0.23
17 0.23
18 0.27
19 0.28
20 0.31
21 0.32
22 0.33
23 0.39
24 0.43
25 0.44
26 0.42
27 0.41
28 0.42
29 0.4
30 0.35
31 0.28
32 0.24
33 0.24
34 0.24
35 0.25
36 0.19
37 0.19
38 0.22
39 0.22
40 0.26
41 0.3
42 0.31
43 0.35
44 0.42
45 0.44
46 0.43
47 0.44
48 0.41
49 0.46
50 0.45
51 0.45
52 0.4
53 0.39
54 0.36
55 0.4
56 0.4
57 0.3
58 0.33
59 0.3
60 0.29
61 0.26
62 0.29
63 0.28
64 0.3
65 0.3
66 0.25
67 0.23
68 0.23
69 0.21
70 0.17
71 0.13
72 0.1
73 0.1
74 0.09
75 0.07
76 0.06
77 0.06
78 0.05
79 0.06
80 0.07
81 0.08
82 0.11
83 0.11
84 0.13
85 0.13
86 0.14
87 0.15
88 0.18
89 0.2
90 0.2
91 0.19
92 0.17
93 0.17
94 0.17
95 0.15
96 0.11
97 0.08
98 0.06
99 0.08
100 0.08
101 0.07
102 0.08
103 0.08
104 0.08
105 0.1
106 0.11
107 0.1
108 0.13
109 0.13
110 0.13
111 0.2
112 0.23
113 0.23
114 0.27
115 0.35
116 0.32
117 0.35
118 0.37
119 0.32
120 0.36
121 0.34
122 0.29
123 0.22
124 0.21
125 0.19
126 0.19
127 0.16
128 0.15
129 0.15
130 0.16
131 0.17
132 0.17
133 0.17
134 0.18
135 0.19
136 0.16
137 0.2
138 0.19
139 0.18
140 0.17
141 0.16
142 0.14
143 0.12
144 0.09
145 0.04
146 0.05
147 0.04
148 0.04
149 0.04
150 0.04
151 0.05
152 0.07
153 0.07
154 0.08
155 0.11
156 0.12
157 0.12
158 0.17
159 0.22
160 0.26
161 0.35
162 0.41
163 0.48
164 0.57
165 0.65
166 0.71
167 0.75
168 0.81
169 0.82
170 0.86
171 0.86
172 0.87
173 0.87
174 0.88
175 0.86
176 0.81