Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S5B2L2

Protein Details
Accession A0A2S5B2L2   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
36-59NQTLTRRKEQQHQHARRKEYPNPIHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 19, mito 3, golg 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPNPNSTLRSAPQSNRGVVFAVSVVAILAGSGYLFNQTLTRRKEQQHQHARRKEYPNPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.4
3 0.38
4 0.32
5 0.26
6 0.23
7 0.14
8 0.1
9 0.07
10 0.06
11 0.05
12 0.04
13 0.03
14 0.03
15 0.02
16 0.02
17 0.02
18 0.02
19 0.02
20 0.03
21 0.03
22 0.04
23 0.07
24 0.1
25 0.17
26 0.22
27 0.28
28 0.34
29 0.38
30 0.47
31 0.54
32 0.63
33 0.67
34 0.73
35 0.79
36 0.81
37 0.85
38 0.85
39 0.84