Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S5AZP1

Protein Details
Accession A0A2S5AZP1    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
273-294LEGADRKKKRRRQSTTVVNKTPHydrophilic
NLS Segment(s)
PositionSequence
278-284RKKKRRR
Subcellular Location(s) nucl 15, cyto 8, mito_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR020472  G-protein_beta_WD-40_rep  
IPR012972  NLE  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
IPR001680  WD40_repeat  
IPR019775  WD40_repeat_CS  
IPR036322  WD40_repeat_dom_sf  
IPR028599  WDR12/Ytm1  
Gene Ontology GO:0005730  C:nucleolus  
GO:0005654  C:nucleoplasm  
GO:0030687  C:preribosome, large subunit precursor  
GO:0043021  F:ribonucleoprotein complex binding  
GO:0000466  P:maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
Pfam View protein in Pfam  
PF08154  NLE  
PF00400  WD40  
PROSITE View protein in PROSITE  
PS00678  WD_REPEATS_1  
PS50082  WD_REPEATS_2  
PS50294  WD_REPEATS_REGION  
Amino Acid Sequences MATADIGQPIASTSTAGLAANGADERQIAIRLSTKDPKFQIPPAKFLVPASWRRFHLSELINKVLENESPIPFDFLIDQTLLRSSLGAYCAATGTSEEVVLEVEFLPSTLPPQLQSTTPSEDWVSDVSLAVRGAVLSASYAGTLSLQHNDLPPPSTLSFAGHDLSVLSACYVPHPLGSEDKRWIASGGMDRVGRVWEYSIPPLSLSAQAEVPAPTTLYTLSLHQAPISSVRSRPLPALPTSSTNAPHLLTAGWDGLIGLWDLTPGVNEGDADLEGADRKKKRRRQSTTVVNKTPMAALRGHTGKISRAVFDRADVTKAYSAGWDHSVRSWDLSIAEEISSKTSDKVLLSMAQLTAPNLLATGSTDRSICLWDLRTEATQNISLTLMGHTAPVSAIAAHPTSSLMFASGSYDSTVRIWDARSPKQALFTLPLPKKEGDEDRTEPEKVLAVDWDGERLVAGGEGARLISWRVSGQEEPSTPMKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.1
4 0.09
5 0.08
6 0.08
7 0.09
8 0.09
9 0.08
10 0.07
11 0.07
12 0.08
13 0.09
14 0.11
15 0.1
16 0.12
17 0.18
18 0.22
19 0.29
20 0.37
21 0.38
22 0.44
23 0.47
24 0.52
25 0.52
26 0.56
27 0.59
28 0.54
29 0.57
30 0.55
31 0.53
32 0.47
33 0.43
34 0.42
35 0.39
36 0.45
37 0.46
38 0.46
39 0.46
40 0.51
41 0.51
42 0.46
43 0.47
44 0.44
45 0.45
46 0.46
47 0.48
48 0.42
49 0.41
50 0.41
51 0.34
52 0.28
53 0.25
54 0.22
55 0.19
56 0.21
57 0.22
58 0.22
59 0.2
60 0.2
61 0.17
62 0.14
63 0.15
64 0.13
65 0.13
66 0.11
67 0.12
68 0.12
69 0.1
70 0.09
71 0.08
72 0.1
73 0.11
74 0.11
75 0.1
76 0.1
77 0.11
78 0.1
79 0.1
80 0.08
81 0.08
82 0.08
83 0.08
84 0.07
85 0.07
86 0.07
87 0.07
88 0.07
89 0.06
90 0.06
91 0.05
92 0.06
93 0.06
94 0.05
95 0.07
96 0.08
97 0.09
98 0.09
99 0.13
100 0.14
101 0.15
102 0.19
103 0.22
104 0.25
105 0.25
106 0.26
107 0.23
108 0.22
109 0.22
110 0.19
111 0.16
112 0.1
113 0.1
114 0.09
115 0.1
116 0.09
117 0.08
118 0.07
119 0.06
120 0.06
121 0.05
122 0.05
123 0.03
124 0.04
125 0.04
126 0.04
127 0.04
128 0.04
129 0.04
130 0.06
131 0.07
132 0.09
133 0.1
134 0.11
135 0.12
136 0.13
137 0.14
138 0.14
139 0.14
140 0.16
141 0.16
142 0.16
143 0.15
144 0.16
145 0.16
146 0.16
147 0.16
148 0.11
149 0.11
150 0.09
151 0.09
152 0.07
153 0.06
154 0.05
155 0.05
156 0.05
157 0.06
158 0.07
159 0.07
160 0.07
161 0.09
162 0.1
163 0.16
164 0.19
165 0.21
166 0.23
167 0.25
168 0.25
169 0.23
170 0.22
171 0.16
172 0.17
173 0.17
174 0.16
175 0.18
176 0.17
177 0.17
178 0.17
179 0.17
180 0.14
181 0.1
182 0.09
183 0.09
184 0.11
185 0.13
186 0.14
187 0.13
188 0.13
189 0.13
190 0.13
191 0.13
192 0.12
193 0.11
194 0.1
195 0.1
196 0.11
197 0.1
198 0.1
199 0.08
200 0.07
201 0.07
202 0.07
203 0.06
204 0.07
205 0.07
206 0.07
207 0.08
208 0.09
209 0.09
210 0.09
211 0.09
212 0.08
213 0.11
214 0.13
215 0.13
216 0.13
217 0.14
218 0.16
219 0.16
220 0.18
221 0.17
222 0.17
223 0.17
224 0.2
225 0.2
226 0.21
227 0.21
228 0.22
229 0.2
230 0.18
231 0.18
232 0.14
233 0.13
234 0.1
235 0.09
236 0.07
237 0.07
238 0.06
239 0.05
240 0.05
241 0.05
242 0.04
243 0.04
244 0.04
245 0.03
246 0.03
247 0.03
248 0.03
249 0.03
250 0.03
251 0.03
252 0.03
253 0.03
254 0.04
255 0.04
256 0.04
257 0.04
258 0.04
259 0.04
260 0.04
261 0.05
262 0.06
263 0.12
264 0.15
265 0.23
266 0.33
267 0.41
268 0.51
269 0.61
270 0.7
271 0.73
272 0.8
273 0.83
274 0.85
275 0.86
276 0.79
277 0.69
278 0.6
279 0.52
280 0.43
281 0.33
282 0.24
283 0.16
284 0.14
285 0.17
286 0.18
287 0.18
288 0.17
289 0.17
290 0.17
291 0.22
292 0.22
293 0.18
294 0.19
295 0.22
296 0.21
297 0.21
298 0.23
299 0.18
300 0.19
301 0.17
302 0.17
303 0.16
304 0.16
305 0.15
306 0.12
307 0.12
308 0.12
309 0.16
310 0.15
311 0.14
312 0.16
313 0.18
314 0.17
315 0.17
316 0.16
317 0.13
318 0.12
319 0.13
320 0.12
321 0.1
322 0.1
323 0.1
324 0.1
325 0.11
326 0.11
327 0.1
328 0.1
329 0.1
330 0.12
331 0.12
332 0.12
333 0.12
334 0.14
335 0.14
336 0.15
337 0.14
338 0.13
339 0.13
340 0.12
341 0.12
342 0.1
343 0.09
344 0.07
345 0.07
346 0.06
347 0.07
348 0.1
349 0.1
350 0.11
351 0.11
352 0.11
353 0.12
354 0.14
355 0.13
356 0.13
357 0.14
358 0.15
359 0.17
360 0.19
361 0.2
362 0.2
363 0.2
364 0.19
365 0.2
366 0.19
367 0.18
368 0.16
369 0.14
370 0.13
371 0.13
372 0.11
373 0.08
374 0.08
375 0.07
376 0.07
377 0.07
378 0.06
379 0.06
380 0.06
381 0.06
382 0.08
383 0.09
384 0.08
385 0.09
386 0.09
387 0.09
388 0.1
389 0.09
390 0.08
391 0.07
392 0.07
393 0.1
394 0.09
395 0.1
396 0.1
397 0.1
398 0.11
399 0.11
400 0.12
401 0.11
402 0.12
403 0.13
404 0.18
405 0.26
406 0.32
407 0.39
408 0.42
409 0.43
410 0.47
411 0.47
412 0.44
413 0.41
414 0.39
415 0.42
416 0.42
417 0.44
418 0.43
419 0.41
420 0.41
421 0.43
422 0.46
423 0.41
424 0.44
425 0.44
426 0.48
427 0.51
428 0.5
429 0.43
430 0.36
431 0.35
432 0.27
433 0.24
434 0.18
435 0.16
436 0.19
437 0.18
438 0.19
439 0.15
440 0.14
441 0.13
442 0.12
443 0.1
444 0.07
445 0.07
446 0.06
447 0.06
448 0.06
449 0.06
450 0.06
451 0.07
452 0.08
453 0.09
454 0.09
455 0.11
456 0.13
457 0.17
458 0.2
459 0.23
460 0.29
461 0.3
462 0.33