Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J7S509

Protein Details
Accession J7S509    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
17-37QDIISKARKYRQDKLKQAKLDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 12.5, cyto 4, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR005124  V-ATPase_G  
Gene Ontology GO:0016471  C:vacuolar proton-transporting V-type ATPase complex  
GO:0046961  F:proton-transporting ATPase activity, rotational mechanism  
Pfam View protein in Pfam  
PF03179  V-ATPase_G  
Amino Acid Sequences MSQNGITTLLRAEKDAQDIISKARKYRQDKLKQAKLDAAAEISAYKATKDQELRDFEKNNQSDVKQLELDAERDIQTDLQEIEKTVAEKKGAVVDLLVKAATNPVGGVHINAQKSHASQKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.22
4 0.21
5 0.21
6 0.25
7 0.29
8 0.28
9 0.28
10 0.34
11 0.42
12 0.47
13 0.56
14 0.62
15 0.65
16 0.74
17 0.81
18 0.83
19 0.78
20 0.73
21 0.67
22 0.59
23 0.5
24 0.39
25 0.3
26 0.2
27 0.16
28 0.14
29 0.1
30 0.08
31 0.06
32 0.06
33 0.07
34 0.08
35 0.13
36 0.15
37 0.18
38 0.24
39 0.29
40 0.33
41 0.36
42 0.37
43 0.35
44 0.41
45 0.38
46 0.34
47 0.3
48 0.26
49 0.25
50 0.24
51 0.24
52 0.15
53 0.15
54 0.16
55 0.15
56 0.15
57 0.12
58 0.13
59 0.1
60 0.11
61 0.11
62 0.09
63 0.08
64 0.09
65 0.08
66 0.09
67 0.09
68 0.08
69 0.1
70 0.1
71 0.11
72 0.12
73 0.14
74 0.13
75 0.13
76 0.14
77 0.17
78 0.16
79 0.15
80 0.13
81 0.14
82 0.14
83 0.14
84 0.13
85 0.09
86 0.09
87 0.1
88 0.1
89 0.07
90 0.06
91 0.06
92 0.08
93 0.09
94 0.1
95 0.14
96 0.19
97 0.2
98 0.2
99 0.22
100 0.23
101 0.25