Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2S5B038

Protein Details
Accession A0A2S5B038    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
74-93GEFSHTKKPARHAPPKSRNGBasic
NLS Segment(s)
PositionSequence
80-91KKPARHAPPKSR
Subcellular Location(s) mito 18.5, cyto_mito 11.833, cyto 4, cyto_nucl 3.333, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR020934  Ribosomal_S15/S19_CS  
IPR002222  Ribosomal_S19  
IPR023575  Ribosomal_S19_S15_SF  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00203  Ribosomal_S19  
PROSITE View protein in PROSITE  
PS00323  RIBOSOMAL_S19  
Amino Acid Sequences MLPTSVLLRAKWKVPFFVPFPGLADAIKTNSPIRTTARNCTIMPFHVGATFLVHNGKDYLPVHVTPAHVGHKLGEFSHTKKPARHAPPKSRNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.4
3 0.37
4 0.41
5 0.37
6 0.31
7 0.31
8 0.29
9 0.26
10 0.2
11 0.19
12 0.13
13 0.14
14 0.14
15 0.13
16 0.13
17 0.14
18 0.15
19 0.16
20 0.18
21 0.25
22 0.28
23 0.33
24 0.37
25 0.38
26 0.37
27 0.37
28 0.35
29 0.27
30 0.27
31 0.21
32 0.16
33 0.12
34 0.13
35 0.1
36 0.11
37 0.1
38 0.08
39 0.08
40 0.08
41 0.08
42 0.09
43 0.09
44 0.11
45 0.12
46 0.14
47 0.15
48 0.15
49 0.17
50 0.17
51 0.18
52 0.15
53 0.18
54 0.18
55 0.17
56 0.17
57 0.17
58 0.18
59 0.18
60 0.17
61 0.19
62 0.2
63 0.23
64 0.32
65 0.38
66 0.39
67 0.42
68 0.5
69 0.56
70 0.62
71 0.69
72 0.7
73 0.75