Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3AP41

Protein Details
Accession G3AP41    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
88-109QQVKEKREKLELKKKEREMKKABasic
NLS Segment(s)
PositionSequence
73-113QLAKQRKEEARAQKLQQVKEKREKLELKKKEREMKKAGFSK
Subcellular Location(s) nucl 21, mito 3, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013730  Fyv7/TAP26  
KEGG spaa:SPAPADRAFT_55609  -  
Pfam View protein in Pfam  
PF08524  rRNA_processing  
Amino Acid Sequences MPADRKSSKKYTDRHASKTADIKRALVHRARIRKNYFKLLKEEGRPDPQETQQEQQQQVEPKKKPVNFAERAQLAKQRKEEARAQKLQQVKEKREKLELKKKEREMKKAGFSKHTRTGQPLMGPRINNLLDKIRNDMKEDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.75
3 0.69
4 0.67
5 0.7
6 0.66
7 0.62
8 0.56
9 0.5
10 0.46
11 0.47
12 0.47
13 0.43
14 0.44
15 0.46
16 0.54
17 0.61
18 0.65
19 0.68
20 0.71
21 0.72
22 0.74
23 0.73
24 0.67
25 0.65
26 0.64
27 0.62
28 0.57
29 0.58
30 0.52
31 0.52
32 0.5
33 0.47
34 0.43
35 0.4
36 0.43
37 0.39
38 0.37
39 0.35
40 0.39
41 0.37
42 0.35
43 0.35
44 0.35
45 0.38
46 0.44
47 0.41
48 0.42
49 0.48
50 0.48
51 0.49
52 0.49
53 0.52
54 0.48
55 0.49
56 0.46
57 0.42
58 0.42
59 0.37
60 0.37
61 0.32
62 0.32
63 0.32
64 0.32
65 0.32
66 0.35
67 0.42
68 0.45
69 0.5
70 0.51
71 0.5
72 0.49
73 0.53
74 0.53
75 0.53
76 0.52
77 0.51
78 0.55
79 0.6
80 0.57
81 0.61
82 0.65
83 0.67
84 0.7
85 0.72
86 0.72
87 0.75
88 0.8
89 0.81
90 0.8
91 0.79
92 0.77
93 0.74
94 0.75
95 0.72
96 0.69
97 0.68
98 0.66
99 0.65
100 0.65
101 0.63
102 0.56
103 0.55
104 0.55
105 0.5
106 0.52
107 0.5
108 0.48
109 0.47
110 0.45
111 0.41
112 0.43
113 0.4
114 0.35
115 0.32
116 0.33
117 0.33
118 0.35
119 0.4
120 0.4
121 0.41