Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2K0VZQ8

Protein Details
Accession A0A2K0VZQ8    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
136-165KDDAEKESAKNRKPKKKAKKIKLSFDEDEGBasic
NLS Segment(s)
PositionSequence
104-120AIGGRKRKVGKVIGEAA
122-157EVKDEGKGEDKKKEKDDAEKESAKNRKPKKKAKKIK
Subcellular Location(s) cyto 13.5, cyto_nucl 11.833, nucl 9, mito_nucl 6.833, cyto_pero 6.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MAPKINSKNLSYDTEAAAPPFLAALRAQAAGATGPNPLLAAQRRSAKKRSSSEEAEDVPLVVDEDGNVVSLVVDKDGVVKDNGDYDVEPATEKETAKESESKAAIGGRKRKVGKVIGEAADEVKDEGKGEDKKKEKDDAEKESAKNRKPKKKAKKIKLSFDEDEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.27
4 0.23
5 0.18
6 0.13
7 0.12
8 0.09
9 0.07
10 0.06
11 0.08
12 0.09
13 0.09
14 0.09
15 0.09
16 0.09
17 0.09
18 0.09
19 0.08
20 0.06
21 0.06
22 0.06
23 0.06
24 0.06
25 0.11
26 0.14
27 0.16
28 0.21
29 0.29
30 0.35
31 0.4
32 0.47
33 0.49
34 0.54
35 0.59
36 0.61
37 0.61
38 0.59
39 0.58
40 0.56
41 0.5
42 0.43
43 0.36
44 0.28
45 0.21
46 0.16
47 0.12
48 0.07
49 0.05
50 0.03
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.05
58 0.05
59 0.04
60 0.04
61 0.04
62 0.05
63 0.06
64 0.07
65 0.06
66 0.06
67 0.06
68 0.08
69 0.08
70 0.07
71 0.07
72 0.07
73 0.07
74 0.07
75 0.07
76 0.06
77 0.07
78 0.09
79 0.09
80 0.09
81 0.11
82 0.12
83 0.14
84 0.18
85 0.18
86 0.21
87 0.21
88 0.2
89 0.18
90 0.2
91 0.22
92 0.24
93 0.31
94 0.3
95 0.37
96 0.39
97 0.41
98 0.44
99 0.46
100 0.44
101 0.43
102 0.45
103 0.39
104 0.37
105 0.35
106 0.3
107 0.24
108 0.2
109 0.14
110 0.09
111 0.07
112 0.07
113 0.07
114 0.14
115 0.2
116 0.23
117 0.32
118 0.39
119 0.45
120 0.49
121 0.57
122 0.54
123 0.58
124 0.63
125 0.62
126 0.63
127 0.64
128 0.61
129 0.62
130 0.66
131 0.63
132 0.64
133 0.66
134 0.69
135 0.73
136 0.82
137 0.85
138 0.88
139 0.92
140 0.94
141 0.95
142 0.94
143 0.95
144 0.93
145 0.9