Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2K0VYI1

Protein Details
Accession A0A2K0VYI1    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
3-28GQCCRKLWISWEKSRRKTKQLQEALKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 2, cyto 2
Family & Domain DBs
Amino Acid Sequences MEGQCCRKLWISWEKSRRKTKQLQEALKEQIEMTRELVKRQKATVQDMSREMVEIKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.73
3 0.82
4 0.81
5 0.79
6 0.8
7 0.79
8 0.8
9 0.8
10 0.78
11 0.72
12 0.7
13 0.65
14 0.55
15 0.46
16 0.35
17 0.27
18 0.21
19 0.17
20 0.14
21 0.18
22 0.18
23 0.22
24 0.28
25 0.31
26 0.32
27 0.34
28 0.37
29 0.35
30 0.42
31 0.47
32 0.46
33 0.46
34 0.46
35 0.45
36 0.4
37 0.36