Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2K0VVK1

Protein Details
Accession A0A2K0VVK1    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MTRAKRRKQPPPPPPPPPPLPPBasic
NLS Segment(s)
PositionSequence
4-17AKRRKQPPPPPPPP
Subcellular Location(s) nucl 13, mito 11, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009288  AIG2-like_dom  
IPR013024  GGCT-like  
Pfam View protein in Pfam  
PF06094  GGACT  
CDD cd06661  GGCT_like  
Amino Acid Sequences MTRAKRRKQPPPPPPPPPPLPPIPQIPPKTTPTGSEPKESSDKDEPTSSDSALYAHSNPKPPDPCPYHYKPVYYFFYDSLRQPAVLQAVLESSEPPKLRDAKVRGYSLAPRGRFTSLVEGQPGSGVLGRAVQVQSAEEEYKLGWYQTSAYVLTPCLIEFIDREEPKELAGLVFTDAGDQRAWRTMRFDYKAWKSQIGTRLPRNWQRSTLEPSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.86
3 0.81
4 0.76
5 0.71
6 0.67
7 0.61
8 0.57
9 0.55
10 0.54
11 0.56
12 0.55
13 0.54
14 0.53
15 0.52
16 0.53
17 0.48
18 0.44
19 0.42
20 0.47
21 0.44
22 0.45
23 0.42
24 0.41
25 0.47
26 0.45
27 0.44
28 0.42
29 0.42
30 0.39
31 0.41
32 0.36
33 0.34
34 0.35
35 0.28
36 0.21
37 0.18
38 0.16
39 0.15
40 0.15
41 0.13
42 0.17
43 0.2
44 0.26
45 0.27
46 0.34
47 0.35
48 0.35
49 0.43
50 0.43
51 0.44
52 0.46
53 0.51
54 0.52
55 0.51
56 0.53
57 0.47
58 0.48
59 0.47
60 0.42
61 0.38
62 0.3
63 0.32
64 0.3
65 0.28
66 0.25
67 0.21
68 0.18
69 0.17
70 0.17
71 0.15
72 0.13
73 0.12
74 0.08
75 0.08
76 0.08
77 0.08
78 0.07
79 0.06
80 0.1
81 0.1
82 0.11
83 0.14
84 0.17
85 0.19
86 0.27
87 0.3
88 0.34
89 0.39
90 0.4
91 0.37
92 0.35
93 0.36
94 0.36
95 0.37
96 0.29
97 0.25
98 0.26
99 0.26
100 0.24
101 0.23
102 0.23
103 0.2
104 0.2
105 0.2
106 0.18
107 0.17
108 0.16
109 0.15
110 0.08
111 0.06
112 0.05
113 0.05
114 0.05
115 0.06
116 0.07
117 0.07
118 0.07
119 0.07
120 0.07
121 0.08
122 0.09
123 0.09
124 0.07
125 0.08
126 0.07
127 0.09
128 0.09
129 0.08
130 0.06
131 0.06
132 0.08
133 0.09
134 0.11
135 0.1
136 0.1
137 0.11
138 0.11
139 0.11
140 0.1
141 0.08
142 0.08
143 0.07
144 0.07
145 0.06
146 0.12
147 0.2
148 0.2
149 0.22
150 0.24
151 0.24
152 0.24
153 0.24
154 0.19
155 0.1
156 0.1
157 0.09
158 0.07
159 0.08
160 0.08
161 0.08
162 0.09
163 0.1
164 0.1
165 0.09
166 0.1
167 0.17
168 0.18
169 0.18
170 0.21
171 0.27
172 0.36
173 0.4
174 0.42
175 0.45
176 0.52
177 0.59
178 0.59
179 0.58
180 0.5
181 0.53
182 0.58
183 0.58
184 0.58
185 0.58
186 0.62
187 0.66
188 0.73
189 0.73
190 0.7
191 0.67
192 0.64
193 0.63