Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2K0WP77

Protein Details
Accession A0A2K0WP77    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
8-32QSMTVHFKLKKGKKQPKRVLLQALEHydrophilic
NLS Segment(s)
PositionSequence
17-24KKGKKQPK
Subcellular Location(s) mito 16, cyto_nucl 6, nucl 5.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MSAAVQTQSMTVHFKLKKGKKQPKRVLLQALEEHYGKQQVGCHHDEKKKELAIKVTKNCDTAEQMKDELWPVLEETEVFKTWEAERIMVLHADTHCTYLLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.38
3 0.46
4 0.55
5 0.62
6 0.72
7 0.74
8 0.84
9 0.89
10 0.89
11 0.88
12 0.85
13 0.82
14 0.74
15 0.7
16 0.62
17 0.54
18 0.46
19 0.38
20 0.32
21 0.24
22 0.22
23 0.16
24 0.13
25 0.14
26 0.16
27 0.2
28 0.23
29 0.26
30 0.32
31 0.36
32 0.38
33 0.38
34 0.38
35 0.36
36 0.36
37 0.34
38 0.34
39 0.37
40 0.42
41 0.44
42 0.44
43 0.43
44 0.41
45 0.4
46 0.34
47 0.31
48 0.29
49 0.26
50 0.23
51 0.22
52 0.21
53 0.21
54 0.2
55 0.16
56 0.12
57 0.1
58 0.08
59 0.08
60 0.08
61 0.07
62 0.09
63 0.12
64 0.12
65 0.12
66 0.12
67 0.14
68 0.14
69 0.21
70 0.19
71 0.17
72 0.17
73 0.18
74 0.19
75 0.17
76 0.17
77 0.14
78 0.13
79 0.18
80 0.17
81 0.18